Recombinant Drosophila ananassae Ubiquitin-conjugating enzyme E2 S (GF21161)

What is the molecular profile of Drosophila ananassae Ubiquitin-conjugating enzyme E2 S?

The Ubiquitin-conjugating enzyme E2 S in Drosophila ananassae, encoded by the GF21161 gene, is a 209 amino acid protein with a molecular mass of 23.384 kDa . The protein belongs to the ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to target proteins . Its complete amino acid sequence is: MSSQYSNVENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGIFRVKLTLNKDFPQTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDDYSQRARMMTEIHAQPAKCAAGAAGDSKDDDGPSTKKHAGLDKKLQDKKKEKLLKEKKRMLKRL . This protein plays a critical role in cell cycle regulation, particularly during mitosis.

How does the genomic context of GF21161 compare to other genes in Drosophila ananassae?

Unlike the amylase genes in Drosophila ananassae which show significant geographical polymorphism and multiple gene copies , the GF21161 gene appears to be more conserved. While amylase genes in D. ananassae organize as two independent pairs of closely linked copies on chromosomal arms 2L and 3L with at least four active genes , ubiquitin-conjugating enzymes tend to be more functionally constrained due to their essential role in protein degradation pathways. Researchers should note that D. ananassae populations show high levels of genetic structure throughout their geographic range , which may impact genetic variation in functional genes like GF21161, particularly in regions with low recombination rates.

What expression systems are optimal for producing recombinant GF21161?

For recombinant expression of GF21161, researchers should consider:

For functional studies, insect cell expression systems often provide the most native-like protein as they can properly process post-translational modifications that may be important for E2 enzyme function . When designing expression constructs, researchers should include a purification tag (His, GST, or MBP) that can be cleaved if necessary for downstream functional assays. Unlike some other proteins, E2 enzymes generally express well as recombinant proteins since they function as relatively independent catalytic units.

How does GF21161 functionally interact with the anaphase-promoting complex/cyclosome (APC/C)?

The Ubiquitin-conjugating enzyme E2 S (GF21161) serves as an essential factor in the anaphase-promoting complex/cyclosome (APC/C), which is a cell cycle-regulated ubiquitin ligase controlling mitotic progression . Mechanistically, GF21161 specifically elongates polyubiquitin chains that are initiated by another E2 enzyme, vih/UbcH10, on APC/C substrates . This elongation enhances the degradation of APC/C substrates by the proteasome, thereby promoting mitotic exit .

When designing experiments to study this interaction, researchers should:

• Use in vitro reconstitution assays with purified components

• Perform co-immunoprecipitation studies to verify interactions

• Conduct cell cycle synchronization experiments to assess temporal dynamics

• Employ fluorescently tagged proteins to visualize subcellular localization during mitosis

This two-step mechanism involving distinct E2 enzymes (initiator and elongator) appears to be a conserved feature in the ubiquitination pathway involved in cell cycle control.

What determines lysine specificity in ubiquitin chain formation by GF21161?

E2 ubiquitin-conjugating enzymes play a crucial role in determining the topology of polyubiquitin chains by directing ubiquitination to specific lysine residues . Studies have shown that E2 enzymes can direct the ubiquitination process to distinct subsets of ubiquitin lysines even in the absence of an E3 enzyme . For GF21161 specifically, its preference likely involves lysine 48-linked chains, which are associated with proteasomal degradation pathways.

Factors that influence lysine specificity include:

• The structural conformation of the E2 active site

• Non-covalent interactions between the E2 and acceptor ubiquitin

• Dimerization of E2 enzymes, as evidence suggests the functional unit of E2 is often a dimer

• Potential allosteric regulation by binding partners

To experimentally determine the lysine specificity of GF21161, researchers should employ mass spectrometry analysis of polyubiquitin chains generated in controlled in vitro ubiquitination reactions with various single lysine ubiquitin mutants .

How can we assess the impact of geographic variation on GF21161 function?

Given the high genetic structure observed in Drosophila ananassae populations across geographical regions , researchers interested in potential functional variation of GF21161 should:

• Sequence and compare GF21161 alleles from multiple geographically distinct D. ananassae populations, particularly focusing on African populations which show higher polymorphism in other genes

• Express and purify recombinant versions of any variant proteins identified

• Conduct comparative enzymatic activity assays to assess functional differences

• Perform population genetics analyses to determine if any observed variations are under selection

What are the optimal conditions for in vitro ubiquitination assays using recombinant GF21161?

For successful in vitro ubiquitination assays with recombinant GF21161, researchers should optimize:

Since GF21161 functions as an elongation E2 enzyme for polyubiquitin chains, researchers should include the initiator E2 (vih/UbcH10 homolog) in the reaction to observe the complete ubiquitination process . Additionally, include appropriate controls such as reactions without ATP, without E1, or with catalytically inactive GF21161 mutants. Analysis should be performed by SDS-PAGE followed by western blotting with anti-ubiquitin antibodies or mass spectrometry for detailed chain topology characterization.

How can genetic approaches be used to study GF21161 function in vivo?

To study GF21161 function in Drosophila ananassae using genetic approaches, researchers should consider:

• CRISPR-Cas9 gene editing: Design guide RNAs targeting GF21161 to generate knockout or knockin strains. When designing guide RNAs, consider the highly structured population genetics of D. ananassae and verify target sequences across different strains to ensure effectiveness.

• RNAi approaches: Develop transgenic flies expressing dsRNA targeting GF21161 under tissue-specific or inducible promoters. This approach allows for temporal and spatial control of gene knockdown.

• Reporter constructs: Create fusion proteins (GF21161-GFP) to track localization and expression patterns throughout development and the cell cycle.

• Genetic interaction studies: Cross GF21161 mutants with strains carrying mutations in other ubiquitination pathway components or APC/C subunits to identify functional relationships.

When phenotyping, pay particular attention to cell cycle defects, developmental abnormalities, and mitotic abnormalities. Given the essential role of the APC/C in cell division , complete loss of GF21161 function may be lethal, necessitating conditional approaches.

What mass spectrometry approaches are most effective for studying GF21161-mediated ubiquitination?

For comprehensive analysis of GF21161-mediated ubiquitination, researchers should employ multiple mass spectrometry (MS) approaches:

• Identification of ubiquitination sites:

  • Perform in vitro ubiquitination reactions with recombinant GF21161

  • Digest samples with trypsin, which leaves a characteristic diglycine remnant on ubiquitinated lysines

  • Use liquid chromatography-tandem mass spectrometry (LC-MS/MS) with enrichment for diglycine-modified peptides

  • Search spectra against databases to identify modified peptides

• Analysis of polyubiquitin chain topology:

  • Use absolute quantification (AQUA) peptides specific for each ubiquitin linkage type

  • Compare the abundance of different linkage types to determine chain specificity

  • Alternatively, use intact mass analysis of polyubiquitin chains followed by top-down MS/MS

• Identification of E2 S substrates:

  • Use stable isotope labeling with amino acids in cell culture (SILAC) followed by ubiquitin remnant profiling

  • Compare cells with normal vs. depleted or mutant GF21161 to identify differential ubiquitination

The E2 enzyme family has been shown to direct ubiquitination to distinct lysine residues even without E3 ligases , making the analysis of chain topology particularly important for understanding GF21161 function.

How does GF21161 compare to homologous E2 enzymes in other Drosophila species?

When comparing GF21161 to homologous E2 enzymes across Drosophila species, researchers should examine:

• Sequence conservation: Align amino acid sequences to identify conserved catalytic residues versus variable regions. Given the essential role of E2 enzymes in protein degradation, high conservation is expected in the catalytic core, while regulatory regions may show more variation.

• Expression patterns: Analyze tissue-specific and developmental expression patterns across species using RNA-seq data or in situ hybridization. Unlike amylase genes which show significant expression variation across populations , ubiquitin pathway genes typically maintain more consistent expression patterns.

• Functional conservation: Test the ability of homologs from different species to complement GF21161 function in in vitro assays or in vivo rescue experiments.

• Evolutionary rate: Calculate the dN/dS ratio to determine if the gene is under purifying selection, positive selection, or neutral evolution across the Drosophila genus.

What can we learn about E2 enzyme evolution from studying GF21161 in the context of Drosophila ananassae population genetics?

Drosophila ananassae provides a unique opportunity to study E2 enzyme evolution due to its highly structured populations across geographic regions . Researchers should:

• Sequence GF21161 from multiple D. ananassae populations, particularly comparing African populations (which show higher genetic diversity in other genes) to Pacific populations .

• Compare patterns of genetic variation in GF21161 to those observed in genes like amylase, which shows marked geographical polymorphism , and vermilion and furrowed, which show high genetic differentiation in regions with low recombination rates .

• Test for signatures of selection by comparing:

  • Patterns of nucleotide diversity (π)

  • Tajima's D statistics

  • FST values between populations

  • Linkage disequilibrium patterns

• Correlate any observed genetic variation with functional differences in enzymatic activity or substrate specificity.

This approach can reveal whether essential cellular components like E2 enzymes evolve differently compared to metabolic enzymes like amylase, which shows evidence of gene duplication events and high polymorphism .

How can researchers troubleshoot insolubility issues with recombinant GF21161?

Insolubility is a common challenge when expressing recombinant E2 enzymes. To overcome this issue:

When designing purification strategies, researchers should ensure their approach maintains the structural integrity required for E2 enzyme function. Unlike some other proteins, E2 enzymes need to maintain specific structural features for catalytic activity and protein-protein interactions with both E1 and E3 enzymes or substrates .

What are the best approaches for analyzing the dimerization of GF21161?

Evidence suggests that the functional unit of E2 enzymes is often a dimer . To analyze GF21161 dimerization:

• Size exclusion chromatography: Use analytical gel filtration to determine the native molecular weight of GF21161 under various conditions.

• Analytical ultracentrifugation: Perform sedimentation velocity and equilibrium experiments to determine association states and binding constants.

• Crosslinking studies: Use chemical crosslinkers followed by SDS-PAGE analysis to capture transient dimers.

• FRET analysis: Generate GF21161 fused to compatible fluorophores (e.g., CFP/YFP) to detect dimerization in solution or in cells.

• Surface plasmon resonance: Immobilize GF21161 and measure binding kinetics of soluble GF21161 to determine dimerization affinity.

• Structural studies: Use X-ray crystallography or cryo-EM to visualize dimer interfaces.

When interpreting results, researchers should consider that dimerization may be concentration-dependent, affected by post-translational modifications, or influenced by binding partners such as E3 ligases or substrates.

How can GF21161 be used as a tool for studying cell cycle regulation?

Ubiquitin-conjugating enzyme E2 S plays a critical role in cell cycle regulation through its interaction with the anaphase-promoting complex/cyclosome (APC/C) . Researchers can leverage this function to:

• Develop cell cycle phase-specific degradation reporters by fusing known APC/C substrates to fluorescent proteins.

• Create dominant-negative GF21161 mutants to selectively inhibit APC/C-mediated protein degradation at specific cell cycle phases.

• Use GF21161 as a probe to identify novel cell cycle regulatory proteins that are subjected to ubiquitin-dependent degradation.

• Develop small molecule inhibitors targeting the GF21161-APC/C interaction as research tools for cell cycle studies.

• Engineer synthetic ubiquitination systems where GF21161 activity is conditionally regulated (e.g., light-inducible or chemically-inducible) to precisely control degradation of proteins of interest.

The specific role of GF21161 in elongating polyubiquitin chains initiated by another E2 enzyme (vih/UbcH10) makes it particularly valuable for studying the sequential and cooperative nature of ubiquitination in cell cycle control.

What insights can studying GF21161 provide about the mechanisms of ubiquitin chain extension?

Studying GF21161 offers unique insights into ubiquitin chain extension mechanisms because it specifically elongates polyubiquitin chains initiated by another E2 enzyme . Key research directions include:

• Chain specificity determination: Investigate how GF21161 recognizes pre-existing ubiquitin moieties on substrates versus unmodified lysines. This can reveal whether chain extension follows a sequential addition model or involves recognition of specific structural features in the initial ubiquitin.

• E2-E2 cooperation: Examine the potential physical or functional interactions between GF21161 and the initiator E2 enzyme (vih/UbcH10). This may involve direct handoff mechanisms or sequential recruitment to E3 ligases.

• Linkage specificity switching: Determine if chain initiation versus extension involves changes in linkage specificity (e.g., from K11 to K48 linkages) and the structural basis for this specificity.

• Processivity factors: Identify factors that enhance the processivity of chain extension by GF21161, potentially including non-catalytic proteins that stabilize the growing chain.

The systematic study of E2 enzymes has shown they can direct ubiquitination to distinct subsets of ubiquitin lysines , making GF21161 an excellent model for understanding how this specificity is achieved in the context of chain extension.