Recombinant Drosophila ananassae Vacuolar ATPase assembly integral membrane protein VMA21 (GF10347)

Shipped with Ice Packs
In Stock

Description

Production and Applications

VMA21 (GF10347) is commercially available as a recombinant protein, primarily used in:

ApplicationDetailsSource
ELISADetection of V-ATPase assembly factors in lysosomal disorders
Structural StudiesMapping protein interactions with V₀ subunits (e.g., ATP6V0C, ATP6AP2)
Functional AssaysTesting proton pump activity in yeast and mammalian models
Cancer ResearchInvestigating tumor-suppressive or -promotive roles in colorectal cancer

Role in V-ATPase Assembly

VMA21 facilitates the assembly of the V₀ domain by interacting with subunit c′ and stabilizing proteolipid rings . Mutations in VMA21 (e.g., R18G, D63G) reduce its binding to ATP6AP2 and V₀ subunits, impairing V-ATPase biogenesis . In patient-derived fibroblasts, VMA21 variants lead to:

  • Reduced V₀ subunit expression (ATP6V0D1, ATP6V0C)

  • Impaired lysosomal acidification (measured via LysoSensor/LysoTracker)

  • Accumulation of lipid droplets in autolysosomes due to defective lipophagy

Impact on Lysosomal Function

In zebrafish models of vma21 deficiency, lysosomal deacidification triggers:

  • Autophagic vacuole formation in muscle fibers (electron-dense structures with naked membranes)

  • Altered autophagic flux (elevated LC3I/LC3II ratio, reduced LC3II/LC3I ratio)

  • Hepatic steatosis and bile flux defects, mimicking human X-linked myopathy with excessive autophagy (XMEA)

Cancer Biology

In colorectal cancer (CRC), high VMA21 expression correlates with:

Disease Models

  • XMEA: VMA21 mutations cause lysosomal neutralization, leading to autophagic myopathy and hepatic steatosis. Zebrafish models confirm impaired lysosomal activity and rescue potential with autophagy modulators (e.g., edaravone) .

  • Congenital Disorders of Glycosylation (CDG): VMA21 variants disrupt N-glycosylation, linking lysosomal dysfunction to metabolic abnormalities .

Therapeutic Targets

  • V-ATPase Modulators: Compounds targeting V₀/V₁ domains may restore lysosomal acidification.

  • Autophagy Regulators: Inhibitors of mTOR or PI3K pathways (e.g., LY294002) show promise in preclinical models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance, incurring additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for prioritized development.
Synonyms
GF10347; Vacuolar ATPase assembly integral membrane protein VMA21 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Drosophila ananassae (Fruit fly)
Target Names
GF10347
Target Protein Sequence
MSNKNKKSGGAGNGAAQKQTRQQSHDSQDYSSFKIVLFYCMLIVFLPVVTFFLLKGFVLD RFFSLSEVKVNIASAVGAVVSLHIALGLYIYRAYFGATGSKAVKED
Uniprot No.

Target Background

Function

Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.

Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

How does VMA21 contribute to V-ATPase assembly in Drosophila systems?

VMA21 functions as an integral membrane protein essential for proper assembly of the V0 domain of V-ATPases. Based on conserved functions across species, the protein likely facilitates the assembly of the proteolipid ring within the V0 domain. The V-ATPase in Drosophila consists of 14 different subunits organized into the cytosolic V1 region and the membrane-bound V0 region . VMA21 is expected to interact with multiple components during assembly, ensuring proper formation of the V0 domain, which forms protein-lipid pores for proton transport. Compromised VMA21 function would likely disrupt V-ATPase assembly, similar to observations in human cells where reduced VMA21 expression leads to decreased V-ATPase activity .

What are the key structural domains of Drosophila ananassae VMA21 protein and their functions?

Drosophila ananassae VMA21 likely contains conserved transmembrane domains that facilitate its integration into the endoplasmic reticulum membrane. While specific structural information for D. ananassae VMA21 is not directly provided in the available research, insights can be drawn from human VMA21 studies. The functional domains would include regions responsible for recognizing V-ATPase subunits, particularly those in the V0 domain. In human cells, VMA21 reduction to approximately 40% of normal expression levels significantly impacts protein function and can lead to pathological conditions , suggesting critical structural domains for proper function.

What are the optimal conditions for heterologous expression of recombinant D. ananassae VMA21?

For optimal heterologous expression of recombinant D. ananassae VMA21 (GF10347), researchers should consider:

  • Expression System Selection:

    • Bacterial systems (E. coli): Use strains optimized for membrane protein expression (C41, C43) with induction at lower temperatures (16-20°C)

    • Insect cell systems: Sf9 or High Five cells with baculovirus vectors offer proper folding and post-translational modifications

    • Yeast systems: Pichia pastoris provides advantages for membrane protein expression

  • Vector Design:

    • Include affinity tags (His, FLAG, or GST) at either N- or C-terminus

    • Consider fusion partners to enhance solubility

    • Include protease cleavage sites for tag removal

  • Expression Conditions:

    • Temperature: Lower temperatures (16-20°C) often improve proper folding

    • Induction parameters: For IPTG-based systems, use 0.1-0.5 mM IPTG

    • Growth media: Enriched media supplemented with appropriate antibiotics

The specific properties of D. ananassae VMA21 should be considered in context of the genetic diversity observed across D. ananassae populations , which might influence protein expression characteristics.

What purification strategies are most effective for maintaining the native conformation of D. ananassae VMA21?

Purification of membrane proteins like VMA21 requires specialized approaches to maintain native conformation:

  • Membrane Preparation:

    • Gentle cell lysis using mechanical disruption or mild detergents

    • Differential centrifugation to isolate membrane fractions

    • Careful washing steps to remove peripheral proteins

  • Solubilization:

    • Screen multiple detergents (DDM, LMNG, CHAPS) at different concentrations

    • Maintain pH close to physiological (pH 7.0-7.5)

    • Include stabilizing agents (glycerol 10-20%, specific lipids)

  • Chromatography Methods:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography to separate protein-detergent complexes

    • Ion exchange chromatography as a polishing step

  • Quality Assessment:

    • Circular dichroism to evaluate secondary structure

    • Thermal stability assays to assess protein folding

    • Functional binding assays with known interacting partners

Successful purification should consider that VMA21 functions in the context of V-ATPase assembly, which involves multiple protein-protein interactions within the V0 domain .

How can researchers verify the functional integrity of purified recombinant VMA21?

Verifying functional integrity of purified recombinant VMA21 requires multiple complementary approaches:

  • Functional Binding Assays:

    • Pull-down experiments with known V-ATPase subunits

    • Surface plasmon resonance to quantify binding kinetics

    • Microplate binding assays with fluorescently labeled partners

  • V-ATPase Assembly Assays:

    • Reconstitution of V-ATPase complex in proteoliposomes

    • ATP hydrolysis assays to measure assembled V-ATPase activity

    • Proton pumping assays using pH-sensitive fluorescent dyes

  • Cell-Based Complementation:

    • Rescue experiments in VMA21-deficient cell lines

    • Measurement of lysosomal/vacuolar acidification

    • Quantification of autophagy markers

  • Comparative Analysis:

    • Activity comparison with wild-type VMA21 protein

    • Structure-function analysis of key domains

    • Thermal stability comparison with known functional variants

A functional VMA21 protein should facilitate V-ATPase assembly, which is essential for ATP-dependent proton pumping in cellular vesicles .

What methods can be used to assess VMA21 involvement in V-ATPase assembly in Drosophila systems?

Several methods can be employed to evaluate VMA21's role in V-ATPase assembly:

  • Genetic Approaches:

    • CRISPR/Cas9-mediated knockout or knockdown of VMA21 in D. ananassae

    • RNAi-based silencing with tissue-specific drivers

    • Rescue experiments using wild-type and mutant VMA21 constructs

  • Biochemical Assays:

    • Co-immunoprecipitation to detect interactions with V-ATPase subunits

    • Blue Native PAGE to visualize intact V-ATPase complexes

    • Density gradient centrifugation to separate assembled complexes

  • Microscopy Techniques:

    • Immunofluorescence to co-localize VMA21 with V-ATPase components

    • Proximity ligation assays to detect protein-protein interactions

    • Electron microscopy to visualize structural defects in V-ATPase assembly

  • Functional Readouts:

    • Measurement of organelle acidification using pH-sensitive dyes

    • Analysis of ATP hydrolysis activity in isolated membrane fractions

    • Assessment of V-ATPase-dependent cellular processes

These methods should consider the tissue-specific distribution patterns observed in V-ATPase subunit isoforms in Drosophila , which might influence the experimental design and interpretation.

How do VMA21 mutations affect V-ATPase function and cellular phenotypes in Drosophila models?

VMA21 mutations in Drosophila models likely produce phenotypes resembling those observed with V-ATPase subunit mutations:

  • Cellular Phenotypes:

    • Impaired vesicular acidification

    • Defects in protein trafficking and degradation

    • Abnormalities in autophagy and lysosomal function

    • Altered endocytic pathway function

  • Tissue-Specific Effects:

    • Wing development defects (similar to those observed with Vha100 isoform mutations)

    • Neuronal abnormalities (synaptic vesicle accumulation, as seen with Vha100-1)

    • Midgut acidification defects (comparable to Vha100-2 and Vha100-4 knockdown)

    • Developmental timing disruptions

  • Molecular Consequences:

    • Reduced V-ATPase assembly and activity

    • Altered gene expression profiles

    • Disruption of pH-dependent signaling pathways

    • Compensatory upregulation of related genes

  • Comparative Analysis:

    Mutation TypeV-ATPase AssemblyCellular PhenotypeDevelopmental Impact
    Null mutationSeverely impairedGlobal acidification defectsLikely lethal
    HypomorphicPartially reducedTissue-specific defectsViable with abnormalities
    Tissue-specificLocally affectedRestricted to expression domainOrgan-specific defects

Human VMA21 mutations causing XMEA show correlation between expression levels and phenotype severity , suggesting similar patterns might exist in Drosophila models.

What techniques can be used to study VMA21 protein interactions within the V-ATPase complex?

Multiple complementary techniques can be employed to characterize VMA21 protein interactions:

  • In Vitro Interaction Assays:

    • Pull-down assays with recombinant proteins

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Chemical crosslinking followed by mass spectrometry

  • Cell-Based Approaches:

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

    • Proximity-dependent biotin identification (BioID)

    • Co-immunoprecipitation from cellular lysates

  • Structural Studies:

    • Cryo-electron microscopy of reconstituted complexes

    • X-ray crystallography of co-crystallized components

    • Hydrogen-deuterium exchange mass spectrometry

    • NMR studies of specific interaction domains

  • Computational Approaches:

    • Molecular docking simulations

    • Molecular dynamics to predict interaction stability

    • Evolutionary coupling analysis

    • Sequence-based interaction prediction

These techniques should account for the complexity of V-ATPase structure, which consists of multiple subunits organized into V1 and V0 domains with VMA21 specifically interacting with components of the V0 domain.

How do the functions of VMA21 differ between Drosophila ananassae and other model organisms?

Comparative analysis of VMA21 across species reveals both conserved and divergent features:

  • Functional Conservation:

    • The core role in V-ATPase assembly is preserved across species

    • Interaction with V0 domain components appears consistent

    • Subcellular localization to the ER membrane is maintained

    • Loss of function consequences (acidification defects) are similar

  • Species-Specific Differences:

    • Drosophila species show varying genetic structures across populations

    • D. ananassae displays unique population dynamics compared to D. melanogaster

    • Expression patterns may vary according to tissue-specific requirements

    • Regulatory mechanisms might differ between species

  • Comparative Analysis Table:

    SpeciesVMA21 StructurePrimary FunctionDisease Association
    Human101/156 amino acidsV-ATPase assemblyXMEA, myopathy
    D. melanogasterSimilar to humanV-ATPase assemblyDevelopmental defects
    D. ananassaePopulation variationV-ATPase assemblyNot well characterized
    YeastConserved domainsV-ATPase assemblyGrowth defects
  • Evolutionary Implications:

    • Sequence conservation suggests strong selective pressure

    • Population-specific variations in D. ananassae might reflect adaptation

    • Functional constraints likely maintain core assembly mechanisms

    • Species-specific modifications may optimize for specific physiological needs

The high genetic structure observed among D. ananassae populations suggests potential adaptation-driven variations in VMA21 function across different geographical isolates.

What insights can human VMA21-associated diseases provide for Drosophila research?

Human VMA21 mutations causing X-linked Myopathy with Excessive Autophagy (XMEA) offer valuable insights for Drosophila researchers:

  • Disease Mechanisms:

    • VMA21 mutations reduce transcript levels to approximately 40% of normal expression

    • Intronic mutations can affect splicing efficiency and intron retention

    • Disease severity correlates with residual VMA21 expression levels

    • Reduced VMA21 leads to impaired V-ATPase assembly and function

  • Experimental Approaches:

    • Genetic models with comparable expression reductions could be created

    • Analysis of splicing efficiency in Drosophila can parallel human studies

    • Similar functional assays (protein levels, V-ATPase activity) can be applied

    • Tissue-specific manifestations can be compared across species

  • Translational Opportunities:

    • Drosophila models can validate human genetic findings

    • High-throughput screening for genetic modifiers is feasible

    • Therapeutic approaches can be preliminarily tested

    • Mechanistic insights can be more rapidly obtained

  • Methodological Considerations:

    • Quantitative RT-PCR to measure transcript levels (similar to human studies)

    • Western blot analysis to assess protein expression

    • Microscopy techniques to evaluate cellular phenotypes

    • Functional assays to measure V-ATPase activity

The intronic mutation c.164-20T>A in human VMA21 demonstrates the importance of analyzing both coding and non-coding regions when studying VMA21 function in Drosophila.

How can VMA21 be used to study population genetics in Drosophila ananassae?

VMA21 offers a valuable tool for population genetics studies in D. ananassae:

  • Genetic Diversity Analysis:

    • Sequencing VMA21 across populations to identify polymorphisms

    • Assessment of coding vs. non-coding variation

    • Calculation of population genetic parameters (π, FST, Tajima's D)

    • Comparison with neutral markers for selection detection

  • Population Structure Investigation:

    • D. ananassae populations show high genetic structure

    • VMA21 can be analyzed alongside microsatellite markers

    • Geographic patterns in VMA21 variation can reveal migration history

    • Correlation with environmental variables may identify adaptive signals

  • Evolutionary Genetics:

    • Tests for adaptive evolution through dN/dS ratio analysis

    • Assessment of regulatory sequence conservation

    • Comparative analysis with other Drosophila species

    • Identification of population-specific functional variants

  • Methodological Framework:

    Analysis TypeMethodsExpected OutcomesRelevance
    Sequence diversityPCR, Sanger/NGS sequencingPolymorphism landscapeGenetic variation patterns
    Population differentiationFST, AMOVAStructure patternsPopulation history
    Selection detectionTajima's D, McDonald-KreitmanSelection signaturesAdaptive evolution
    Functional validationSite-directed mutagenesisPhenotypic effectsVariant significance

The analysis should consider that D. ananassae populations from Southeast Asia are ancestral, with complex expansion patterns into the Pacific involving multiple colonization events .

What CRISPR-Cas9 strategies are most effective for studying VMA21 function in Drosophila ananassae?

Effective CRISPR-Cas9 approaches for studying VMA21 function include:

  • Knockout Strategies:

    • Design multiple sgRNAs targeting conserved exons

    • Target 5' coding regions to ensure complete loss of function

    • Create conditional knockouts using Gal4-UAS system

    • Generate tissue-specific knockouts to bypass potential lethality

  • Knock-in Approaches:

    • Epitope tagging for protein localization and interaction studies

    • Introduction of fluorescent reporters for live imaging

    • Creation of point mutations mimicking human disease variants

    • Integration of inducible degradation domains for temporal control

  • Regulatory Element Modification:

    • Targeting splicing regulatory elements based on human intronic mutation insights

    • Modifying promoter regions to alter expression levels

    • Engineering enhancer elements for spatial expression control

    • Creating reporter constructs to monitor transcriptional activity

  • Technical Considerations:

    • Optimization of guide RNA design for D. ananassae genome

    • Appropriate donor template design for homology-directed repair

    • Efficient delivery methods for embryo microinjection

    • Reliable screening strategies for successful editing events

These approaches should account for the potential tissue-specific requirements of VMA21, similar to those observed for V-ATPase subunit isoforms in Drosophila .

How can researchers investigate the role of VMA21 in tissue-specific V-ATPase functions?

Investigation of VMA21's tissue-specific roles requires multi-faceted approaches:

  • Expression Pattern Analysis:

    • Tissue-specific transcriptomics to quantify VMA21 expression

    • In situ hybridization to visualize mRNA distribution

    • Reporter gene constructs to monitor promoter activity

    • Antibody staining to detect protein localization

  • Tissue-Specific Manipulation:

    • Gal4-UAS system for targeted overexpression or RNAi

    • Tissue-specific CRISPR-Cas9 expression

    • Clonal analysis to create genetic mosaics

    • Temperature-sensitive or drug-inducible systems for temporal control

  • Functional Assessment:

    • Organelle acidification measurements in different tissues

    • ATP hydrolysis assays in isolated tissue samples

    • V-ATPase assembly analysis in tissue-specific contexts

    • Phenotypic characterization of tissue-specific defects

  • Comparative Analysis:

    • Correlation with V-ATPase subunit isoform expression patterns

    • Comparison with known tissue-specific V-ATPase functions

    • Assessment of compensatory mechanisms in different tissues

    • Evaluation of tissue-specific interaction partners

This investigation should consider that V-ATPase subunits in Drosophila show distinct tissue distribution patterns and isoform-specific functions, as observed with the Vha100 subunit isoforms .

What are common pitfalls in expression and purification of recombinant VMA21 and how can they be addressed?

Researchers encounter several challenges when working with recombinant VMA21:

  • Low Expression Yields:

    • Problem: Membrane proteins often express poorly

    • Solutions: Use specialized expression strains (C41/C43 E. coli), reduce induction temperature, optimize codon usage, employ eukaryotic expression systems, add fusion partners to enhance solubility

  • Protein Aggregation:

    • Problem: Improper folding leading to inclusion bodies

    • Solutions: Screen multiple detergents for solubilization, include stabilizing agents (glycerol, specific lipids), optimize buffer conditions, use mild solubilization approaches, consider nanodiscs or amphipols for stabilization

  • Loss of Function During Purification:

    • Problem: Native conformation disruption during isolation

    • Solutions: Maintain physiological pH, include cofactors, minimize exposure to harsh conditions, validate function at each purification step, preserve native lipid environment when possible

  • Contaminating Proteins:

    • Problem: Co-purification of interacting partners

    • Solutions: Include additional purification steps, use stringent washing conditions, apply on-column unfolding/refolding, validate purity by mass spectrometry

Understanding the interaction of VMA21 with V-ATPase components and its role in assembly can help anticipate and address these challenges.

How can researchers overcome the challenges of studying VMA21 interactions in vivo?

In vivo study of VMA21 interactions presents unique challenges:

  • Visualization Difficulties:

    • Problem: Low abundance and membrane localization

    • Solutions: Use super-resolution microscopy, employ signal amplification techniques, develop highly specific antibodies, utilize proximity-based labeling approaches (BioID, APEX)

  • Functional Redundancy:

    • Problem: Compensatory mechanisms masking phenotypes

    • Solutions: Generate combined knockdowns of related genes, use acute protein degradation systems, employ sensitized genetic backgrounds, analyze subtle phenotypes with quantitative methods

  • Developmental Requirements:

    • Problem: Essential function leading to early lethality

    • Solutions: Use conditional alleles, employ tissue-specific manipulation, create hypomorphic alleles, analyze clonal knockouts, use temperature-sensitive systems

  • Technical Considerations:

    • Problem: Complex genetic manipulation in D. ananassae versus D. melanogaster

    • Solutions: Adapt established protocols for D. ananassae, optimize transformation efficiency, utilize universal genetic tools, consider heterologous expression in D. melanogaster

These approaches should be informed by knowledge of V-ATPase subunit functions in Drosophila and the genetics of D. ananassae populations .

What experimental controls are essential when conducting functional assays with recombinant VMA21?

Rigorous controls are critical for reliable functional assays with VMA21:

  • Expression and Purification Controls:

    • Negative control: Empty vector/mock purification

    • Positive control: Well-characterized membrane protein

    • Quality controls: Size exclusion profiles, thermal stability assays, circular dichroism

    • Validation: Mass spectrometry confirmation, N-terminal sequencing

  • Functional Assay Controls:

    • Negative control: Heat-denatured VMA21 protein

    • Positive control: Native V-ATPase preparations

    • Specificity control: Unrelated membrane protein

    • Dose-response: Titration of VMA21 concentration

  • Interaction Studies:

    • Negative control: Non-interacting proteins

    • Positive control: Known V-ATPase component interactions

    • Competition assays: Displacement with unlabeled protein

    • Mutant variants: Structure-function validation

  • In Vivo Validation:

    • Rescue experiments: Complementation with wild-type VMA21

    • Comparison with established phenotypes: V-ATPase subunit mutations

    • Tissue-specific controls: Expression in relevant vs. irrelevant tissues

    • Temporal controls: Staged expression during development

Proper controls should consider the relationship between VMA21 expression levels and functional outcomes, as demonstrated in studies of human VMA21 mutations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.