Recombinant Drosophila athabasca Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life is influenced by storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila athabasca (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNVEFDS YMIPTNELANDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS
Uniprot No.

Target Background

Function

Recombinant Drosophila athabasca Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation, a process involving three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen. This electron transfer generates an electrochemical gradient across the inner mitochondrial membrane, powering transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) composed of heme A3 and copper B (CuB). The BNC utilizes four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Cytochrome c oxidase in Drosophila mitochondria?

Cytochrome c oxidase serves as the terminal enzyme of the mitochondrial electron transfer chain in Drosophila, as in other eukaryotes. The enzyme is composed of both mitochondrial DNA-encoded subunits (including mt:CoII) and nuclear DNA-encoded subunits . In Drosophila melanogaster specifically, research indicates the presence of 9 putative nuclear cytochrome c oxidase subunits with high identity scores compared to the 10 human subunits, notably lacking the VIIb subunit .

The mt:CoII subunit contributes to the core catalytic function of the enzyme complex, facilitating the transfer of electrons from cytochrome c to molecular oxygen. This process is coupled to proton pumping across the inner mitochondrial membrane, contributing to the electrochemical gradient that drives ATP synthesis—the primary energy currency for cellular functions.

How does mt:CoII expression vary during Drosophila development?

Research on cytochrome c oxidase subunits in Drosophila indicates that expression patterns are both maternal and developmental, with specific localization in various tissues. Transcripts are predominantly found in:

  • The central nervous system of embryos

  • Central regions of imaginal discs

  • Germarium, follicular, and nurse cells of the ovary

  • Testis

This tissue-specific expression pattern suggests that mt:CoII and related cytochrome c oxidase components play particularly important roles in tissues with high energy demands during development.

What is the optimal protocol for reconstituting lyophilized recombinant mt:CoII protein?

For optimal reconstitution of lyophilized Recombinant Drosophila athabasca mt:CoII protein:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard practice)

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

This procedure helps maintain protein stability and prevents damage from repeated freeze-thaw cycles . For experimental consistency, it's recommended to prepare single-use aliquots, as repeated freezing and thawing can significantly reduce protein activity and integrity.

How can researchers effectively verify the purity and activity of recombinant mt:CoII protein?

To verify the purity and functional activity of recombinant mt:CoII:

For purity assessment:

  • SDS-PAGE analysis remains the gold standard, with properly purified recombinant mt:CoII showing >90% purity

  • Western blotting using anti-His antibodies can confirm the identity of the protein

  • Mass spectrometry can provide precise molecular weight confirmation

For functional activity assessment:

  • Spectrophotometric assays measuring cytochrome c oxidation rates

  • Oxygen consumption measurements in reconstituted systems

  • Comparative analysis with native mitochondrial preparations

When interpreting results, researchers should consider that the recombinant protein contains a His-tag, which may slightly alter molecular weight compared to the native form. Additionally, activity may differ from the native protein due to differences in post-translational modifications between E. coli expression systems and the native Drosophila environment.

What are the most effective experimental approaches for studying mt:CoII interactions with other mitochondrial proteins?

Several complementary approaches are recommended for investigating mt:CoII protein interactions:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag of recombinant mt:CoII or against potential interacting partners to pull down protein complexes

  • Yeast two-hybrid screening: For identifying novel protein interactions

  • Surface plasmon resonance (SPR): For quantifying binding kinetics and affinities

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): For studying native mitochondrial complexes

  • Crosslinking mass spectrometry: For mapping interaction interfaces

When studying mitochondrial protein complexes, it's crucial to consider that the recombinant mt:CoII expressed in E. coli may lack the appropriate mitochondrial environment for authentic interactions. Therefore, validation in mitochondrial preparations or through heterologous expression in eukaryotic cells is strongly recommended.

How does Drosophila athabasca mt:CoII compare evolutionarily to other Drosophila species?

Evolutionary analysis of mt:CoII across Drosophila species reveals important insights into selective pressures acting on mitochondrial genes. Based on comparative analyses of dN/dS ratios (the ratio of non-synonymous to synonymous substitution rates) for cox2 (the gene encoding mt:CoII) across different Drosophila subgroups:

Drosophila SubgroupdNdSdN/dS
Ananassae subgroup0.00491.30340.003759
Montium group0.01645.08640.003224
Suzukii subgroup0.00671.45630.004601

These low dN/dS ratios (<1) indicate strong purifying selection acting on the cox2 gene , suggesting that the protein's function is highly conserved across Drosophila evolution. The relatively higher dN/dS ratio in the Suzukii subgroup may indicate slightly relaxed selective constraints in this lineage.

The evolutionary conservation of mt:CoII highlights its fundamental importance in mitochondrial function across Drosophila species, making it a valuable model for studying mitochondrial evolution and adaptation.

What research approaches are most effective for studying recombination events involving the mt:CoII gene?

Research on mitochondrial recombination, including genes like mt:CoII, has benefited from innovative experimental approaches in Drosophila:

  • Creation of heteroplasmic lines: Transferring cytoplasm between early Drosophila embryos creates flies with mixed mitochondrial populations that persist for multiple generations

  • Selective pressure using restriction enzymes: Expression of mitochondrially-targeted restriction enzymes creates selection against mitochondrial genomes carrying specific cleavage sites

  • Temperature-dependent selection: Exploiting temperature-sensitive mitochondrial mutations to select for or against specific genomes

  • PCR-RFLP analysis: For detecting and quantifying recombinant genomes through restriction site polymorphisms

These approaches have successfully demonstrated that mitochondrial recombination does occur in Drosophila and can be manipulated for functional mapping of mitochondrial genes . The research indicates that even rare recombination events can uncouple positively selected drive mutations from detrimental mutations, potentially preventing the extinction of lineages carrying dysfunctional mitochondrial variants.

How do mutations in mt:CoII affect mitochondrial function across different Drosophila species?

Mutations in mt:CoII can have significant impacts on mitochondrial function, though the effects can vary by species and mutation type:

  • Temperature-sensitive mutations: Some mutations in cytochrome c oxidase genes create temperature-dependent lethality, affecting organismal fitness only under specific environmental conditions

  • Selfish drive mutations: Certain mitochondrial variants show transmission advantages (selfish drive) even when they carry functional defects, creating what researchers describe as "population time bombs"

  • Compensatory mutations: Nuclear-encoded proteins may evolve to compensate for suboptimal mitochondrial variants, creating species-specific compatibility patterns

Research using heteroplasmic Drosophila lines has shown that recombination can separate beneficial and detrimental mutations, allowing natural selection to restore mitochondrial function . This mechanism may be crucial for maintaining mitochondrial genome integrity over evolutionary time.

What strategies can researchers employ to investigate the role of post-translational modifications in mt:CoII function?

Investigating post-translational modifications (PTMs) of mt:CoII requires multiple approaches:

  • Mass spectrometry-based proteomics: For comprehensive mapping of PTMs including phosphorylation, acetylation, and other modifications

  • Site-directed mutagenesis: Creating recombinant proteins with mutations at putative modification sites

  • Chemical modification inhibitors: Using specific inhibitors of protein modification enzymes

  • Antibodies against specific modifications: For detection and quantification of modified protein forms

Since the E. coli expression system commonly used for recombinant mt:CoII production lacks many eukaryotic PTM enzymes, researchers should be aware that recombinant protein may not reflect the native modification state. Complementary studies using native mitochondrial preparations or expression in eukaryotic systems can provide more physiologically relevant insights.

How can researchers design experiments to study the assembly of mt:CoII into functional cytochrome c oxidase complexes?

Designing experiments to study mt:CoII assembly requires consideration of several factors:

  • In vitro reconstitution experiments: Using purified recombinant mt:CoII along with other subunits to reconstitute functional complexes

  • Import assays: Studying the import of recombinant mt:CoII into isolated mitochondria

  • Pulse-chase experiments: Following the time course of assembly using labeled proteins

  • Conditional knockout or knockdown systems: Depleting endogenous protein to study assembly defects

  • Cryo-electron microscopy: For structural analysis of assembly intermediates

Since cytochrome c oxidase is composed of both mitochondrial-encoded subunits (including mt:CoII) and nuclear-encoded subunits, successful assembly studies must account for the coordinated expression and interaction of components from both genomes. In Drosophila, this includes 9 putative nuclear cytochrome c oxidase subunits with high identity to human counterparts .

What advanced techniques can be applied to investigate the interaction between mt:CoII and potential inhibitors or activators?

Several sophisticated approaches can be employed to study mt:CoII interactions with inhibitors or activators:

  • Isothermal titration calorimetry (ITC): For thermodynamic characterization of binding interactions

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map conformational changes upon ligand binding

  • Molecular dynamics simulations: For in silico prediction of binding modes and effects

  • Electrophysiological measurements: To assess functional impacts on proton pumping

  • Structure-based drug design: Using homology models based on crystallographic data from related species

When interpreting results, researchers should consider that the recombinant mt:CoII, especially with an N-terminal His-tag , may exhibit different binding properties compared to the native protein embedded in the mitochondrial membrane. Validation using native mitochondrial preparations is strongly recommended.

What approaches can overcome solubility challenges with recombinant mt:CoII protein?

As a mitochondrial membrane protein, mt:CoII presents several solubility challenges that researchers can address using these strategies:

  • Detergent screening: Systematic testing of different detergents (ionic, non-ionic, and zwitterionic) for optimal solubilization

  • Addition of lipids: Including phospholipids that mimic the mitochondrial membrane environment

  • Co-expression with chaperones: Using specialized E. coli strains with chaperone overexpression

  • Alternative tags: Testing different solubility-enhancing tags beyond the standard His-tag

  • Refolding protocols: Developing step-wise refolding from inclusion bodies using decreasing concentrations of denaturants

The standard storage buffer for recombinant mt:CoII includes Tris/PBS-based buffer with 6% Trehalose at pH 8.0 , which has been optimized to maintain solubility. For experiments requiring different buffer conditions, researchers should perform small-scale solubility tests before proceeding to larger-scale work.

How can researchers troubleshoot expression yield problems with recombinant mt:CoII?

When facing low yields of recombinant mt:CoII expression, consider these troubleshooting approaches:

  • Expression strain optimization: Testing multiple E. coli strains (BL21, Rosetta, C41/C43) specialized for membrane protein expression

  • Induction condition variations: Systematically varying temperature, IPTG concentration, and induction duration

  • Codon optimization: Redesigning the gene sequence to match E. coli codon usage preferences

  • Fusion partners: Adding solubility-enhancing fusion partners such as MBP, GST, or SUMO

  • Growth media optimization: Testing rich media formulations or supplementing with specific cofactors

It's important to note that as a mitochondrial membrane protein, mt:CoII may inherently express at lower levels than soluble proteins. Optimization efforts should focus on maximizing the yield of correctly folded, functional protein rather than simply increasing total protein production.

What are the critical factors in designing experiments to study mt:CoII function in the context of mitochondrial disease models?

When designing experiments to investigate mt:CoII in mitochondrial disease contexts:

  • Select appropriate disease models: Choose models that reflect specific mutations or functional defects relevant to the research question

  • Control for genetic background effects: Use isogenic or congenic lines to minimize confounding variables

  • Implement tissue-specific analyses: Focus on tissues with high expression, such as the central nervous system, imaginal discs, or reproductive tissues

  • Combine in vitro and in vivo approaches: Validate findings from recombinant protein studies in cellular and organismal contexts

  • Consider heteroplasmy dynamics: Account for the effects of mixed populations of mitochondrial genomes

Research has shown that selection can isolate recombinant mitochondrial genomes in animals, including those with mutations affecting cytochrome c oxidase function . These approaches can be leveraged to create and study specific disease-relevant mt:CoII variants and their phenotypic consequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.