Recombinant Drosophila azteca Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila azteca (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNVEFDS YMIPTNELANDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISNSVNS
Uniprot No.

Target Background

Function

Recombinant Drosophila azteca Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation, a crucial process in cellular energy production. The respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes collaboratively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) composed of heme A3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does D. azteca mt:COII differ structurally from other Drosophila species?

Comparative analysis of mt:COII sequences across Drosophila species reveals significant evolutionary divergence, particularly between Nearctic and Palearctic species. D. azteca, belonging to the affinis subgroup, shows closer phylogenetic relationships to Nearctic obscura species than expected based on traditional taxonomy .

Sequence alignment studies demonstrate variable rates of evolution in different lineages, with some evolving at rates two to three times greater than others . This variability is particularly pronounced in the third codon positions, which show saturation between distantly related species with ti/tv ratios ranging from 6.750 to 0.581 .

What are the optimal storage and reconstitution conditions for recombinant D. azteca mt:COII?

For optimal stability and activity of recombinant D. azteca mt:COII:

  • Storage conditions: Store the lyophilized powder at -20°C/-80°C upon receipt. For extended storage, maintain at -20°C or -80°C to preserve protein integrity .

  • Reconstitution protocol:

    • Centrifuge the vial briefly before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended: 50%)

    • Aliquot for long-term storage at -20°C/-80°C

    • For working solutions, store aliquots at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this degrades protein quality

How can recombinant D. azteca mt:COII be used in phylogenetic studies?

Recombinant D. azteca mt:COII serves as a valuable tool for phylogenetic analyses of the Drosophila obscura group. Researchers can utilize this protein in several methodological approaches:

  • Restriction-site analysis: Examine mtDNA patterns by restriction enzyme digestion, comparing fragment patterns across species to establish evolutionary relationships .

  • Sequence-based phylogeny:

    • PCR amplification of the mt:COII gene using conserved primers

    • Sanger sequencing of amplified products

    • Sequence alignment using programs like ClustalW

    • Phylogenetic tree construction using maximum likelihood, Bayesian inference, or maximum parsimony methods

  • Saturation analysis: Plot transitions/transversions (ti/tv) ratios against total substitutions to evaluate sequence evolution rates and potential phylogenetic signal deterioration .

When conducting such studies, it's critical to evaluate potential long-branch attraction (LBA) artifacts, particularly when analyzing divergent lineages. Model-based methods (ML and Bayesian approaches) generally show greater robustness against branch-length differences and can mitigate LBA issues .

What are the recommended protocols for functional studies of recombinant mt:COII?

For functional characterization of recombinant D. azteca mt:COII:

  • Cytochrome c oxidase activity assay:

    • Isolate mitochondria from cells expressing the recombinant protein

    • Measure oxygen consumption using polarography or spectrophotometric methods

    • Quantify electron transfer rates from reduced cytochrome c to oxygen

    • Compare activity with native enzyme or other recombinant variants

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with other COX subunits

    • Blue Native PAGE (BN-PAGE) analysis to assess integration into Complex IV

    • Cross-linking experiments to identify interaction partners

  • In-gel activity assays:

    • Solubilize mitochondrial membranes with n-dodecyl-β-D-maltoside (DDM)

    • Separate respiratory complexes by BN-PAGE

    • Perform in-gel activity staining for COX

    • Conduct Western blot immunodetection using antibodies against specific subunits

How can CRISPR-based mitochondrial editing be applied to study mt:COII function?

Recent advances in mitochondrial genome editing offer new approaches to study mt:COII function:

  • DddA-derived cytosine base editors (DdCBEs):

    • Design TALE DNA binding domains targeting mt:COII gene regions

    • Engineer split DddAtox bacterial cytidine deaminase fragments

    • Introduce C:G to T:A mutations at specific sites

    • Assess resultant phenotypes and complex assembly

  • Mitochondrial adenine base editing:

    • Design TALEs targeted to the mt:COII gene

    • Introduce A:T to G:C conversions at specific positions

    • Create knockout models by introducing premature stop codons

    • Analyze respiratory function in edited cells/organisms

  • Functional validation:

    • Measure Complex IV activity using spectrophotometric assays

    • Assess respiratory capacity through oxygen consumption measurements

    • Evaluate ROS production and mitochondrial membrane potential

    • Analyze effects on cellular viability and apoptosis

What insights does D. azteca mt:COII provide about the evolution of the Drosophila obscura group?

D. azteca mt:COII has played a pivotal role in revising our understanding of the Drosophila obscura group phylogeny:

  • Revised taxonomic relationships: mtDNA analysis of D. azteca (affinis subgroup) and other obscura group species revealed that Nearctic obscura species are more closely related to D. azteca than to Palearctic obscura species, challenging traditional classification .

  • Heterogeneous evolution: The three Palearctic species (D. obscura, D. ambigua, and D. subobscura) form a highly heterogeneous group. D. obscura shows no closer relationship to D. subobscura and D. ambigua than to D. affinis or the Nearctic obscura species .

  • Variable evolutionary rates: Some lineages have evolved at rates two to three times greater than others, indicating non-uniform molecular clock behavior in this gene region .

These findings necessitate reconsideration of the obscura group phylogeny, with significant implications for understanding speciation processes and biogeographic patterns in Drosophila evolution.

How do mt:COII sequence characteristics compare across Drosophila species in different geographic regions?

Comparative analysis of mt:COII sequences across geographically distinct Drosophila populations reveals significant genetic diversity:

Geographic OriginSpecies ExampleSequence Length (bp)Notable CharacteristicsGenetic Distance*
Nearctic (North America)D. azteca688-700Closer relation to Nearctic obscura speciesReference
NearcticD. pseudoobscura688-700High ti/tv ratio (6.750) with D. mirandaLow
NearcticD. persimilis688-700Similar to D. miranda (ti/tv = 0.00)Low
Palearctic (Europe/Asia)D. obscura688-700Heterogeneous group memberHigh
PalearcticD. subobscura688-700Distinct from D. obscuraModerate
North SulawesiDrosophila sp. (Bolaang)688-700Greatest sequence divergenceVery High

*Relative to D. azteca

Analysis of North Sulawesi Drosophila populations demonstrates particularly high genetic variation, with the Bolaang population showing the greatest sequence characteristic differences and genetic distance from other regional populations .

What does the variable evolution rate of mt:COII tell us about selection pressures in different Drosophila lineages?

The variable evolution rates observed in mt:COII across Drosophila lineages provide key insights into selection pressures:

  • Differential selection pressures: The two- to three-fold differences in evolution rates between lineages suggest varying selection pressures, potentially related to ecological adaptation, metabolic requirements, or co-evolution with nuclear-encoded subunits .

  • Saturation effects: The decreasing transitions/transversions (ti/tv) ratios observed in third codon positions with increasing pairwise distance indicate saturation effects. This pattern is particularly evident in comparisons between distantly related species, suggesting long-term divergent evolution under different selective constraints .

  • Functional constraints: Despite sequence divergence, the core function of mt:COII in cytochrome c oxidase must be maintained, indicating strong functional constraints on certain protein domains. Variation likely occurs predominantly in regions that do not compromise essential enzyme activity .

  • Co-evolution with nuclear subunits: The evolution rate of mt:COII may reflect co-evolutionary dynamics with nuclear-encoded cytochrome c oxidase subunits, necessitating compensatory mutations to maintain proper complex assembly and function .

How can recombinant D. azteca mt:COII be used to investigate mitochondrial involvement in apoptosis?

Recombinant D. azteca mt:COII provides a valuable tool for investigating the dual role of mitochondrial components in both respiration and apoptosis:

  • Cytochrome c release studies:

    • Reconstruct mitochondrial membranes with recombinant mt:COII

    • Monitor cytochrome c release under apoptotic stimuli

    • Compare response with other Drosophila species

    • Evaluate interaction with Ark (Drosophila Apaf-1 homolog)

  • Apoptotic pathway analysis:

    • Examine whether mt:COII influences cytochrome c binding to Ark

    • Investigate if mt:COII mutations affect apoptosome formation

    • Assess downstream caspase activation using CM1 staining for drICE

    • Evaluate effects on Hid accumulation and Diap1 regulation

Research has established that in Drosophila, as in vertebrates, cytochrome c functions to transduce apoptotic signals through Apaf-1 (Ark), with mitochondrial cytochrome c showing shifts in localization during apoptosis. The mt:COII subunit may influence this process through effects on respiratory chain function and mitochondrial membrane stability .

What are the implications of mtDNA editing of mt:COII for models of mitochondrial disease?

Recent advances in mitochondrial genome editing technologies have significant implications for creating disease models targeting mt:COII:

  • Disease modeling approaches:

    • Introduce specific pathogenic mutations in mt:COII using DdCBEs or adenine base editors

    • Create heteroplasmic models with varying mutant load

    • Assess effects on Complex IV assembly and function

    • Investigate tissue-specific consequences in Drosophila models

  • Therapeutic development platform:

    • Screen compounds for rescue of mt:COII mutations

    • Test gene therapy approaches in Drosophila disease models

    • Evaluate mitochondrial-targeted antioxidants for efficacy

    • Assess compensatory mechanisms that might be therapeutically enhanced

Research demonstrates that base editing technologies can achieve both in vitro and in vivo mitochondrial genome modifications with therapeutic potential. The ability to introduce precise mutations in mt:COII provides unprecedented opportunities for studying mitochondrial diseases related to Complex IV deficiency .

How can data from partition homogeneity tests be interpreted when analyzing mt:COII in phylogenetic studies?

Partition homogeneity tests (PHT) are critical for evaluating congruence between different genetic regions in phylogenetic analyses:

  • Interpreting PHT results:

    • P-values below 0.05 indicate significant incongruence between partitions

    • PHT between mt:COII and other mitochondrial genes (e.g., COI) often shows incongruence (P = 0.012)

    • Six-parameter weighting schemes may reduce incongruence (e.g., improving P-value from 0.012 to 0.135)

  • Causes of incongruence:

    • Different evolutionary histories

    • Varying evolutionary rates

    • Saturation in some gene regions

    • Long-branch attraction artifacts

    • Model violations in phylogenetic methods

  • Methodological solutions:

    • Apply appropriate weighting schemes based on codon positions

    • Implement model-based methods (ML or Bayesian)

    • Conduct separate analyses of partitions showing incongruence

    • Perform sensitivity analyses with different outgroups

Recent studies suggest that incongruence between mt:COII and other gene regions may reflect biological reality rather than methodological artifacts, indicating potentially complex evolutionary histories within the Drosophila obscura group .

What strategies can address low activity of recombinant D. azteca mt:COII in functional assays?

When encountering low activity of recombinant D. azteca mt:COII in functional assays, consider these methodological approaches:

  • Protein quality assessment:

    • Verify protein integrity by SDS-PAGE (>90% purity recommended)

    • Confirm proper folding through circular dichroism spectroscopy

    • Assess aggregation state by size exclusion chromatography

    • Check for post-translational modifications that might affect function

  • Optimization strategies:

    • Adjust reconstitution conditions (pH, ionic strength, detergents)

    • Test different membrane reconstitution methods

    • Add cardiolipin or other phospholipids to stabilize the protein

    • Evaluate activity in the presence of other COX subunits

  • Expression system considerations:

    • Compare E. coli-expressed protein with other expression systems

    • Consider co-expression with chaperones to improve folding

    • Evaluate alternative purification strategies to preserve activity

    • Test tag removal if His-tag interference is suspected

How can contradictory phylogenetic signals in mt:COII sequence data be resolved?

Researchers often encounter contradictory phylogenetic signals when analyzing mt:COII sequence data. Here are approaches to resolve these conflicts:

  • Data partitioning strategies:

    • Separate analyses by codon position

    • Apply differential weighting schemes

    • Exclude saturated sites (often 3rd codon positions)

    • Use mixed models that accommodate heterogeneity

  • Model selection approaches:

    • Perform likelihood ratio tests for model selection

    • Use Akaike Information Criterion (AIC) to evaluate models

    • Implement partitioned models with position-specific parameters

    • Consider codon-based substitution models

  • Phylogenetic method comparison:

    • Compare trees from MP, ML, and Bayesian inference

    • Assess nodal support through bootstrapping or posterior probabilities

    • Implement quartet puzzling to identify problematic taxa

    • Use consensus methods to identify consistent relationships

Research has shown that when analyzing the Drosophila obscura group, model-based methods (ML and Bayesian inference) often outperform maximum parsimony, particularly in resolving the placement of species like D. microlabis that may be affected by long-branch attraction artifacts .

What controls should be included when using recombinant D. azteca mt:COII in comparative studies?

Robust experimental design for comparative studies using recombinant D. azteca mt:COII should include these controls:

  • Protein-level controls:

    • Recombinant mt:COII from closely related species (e.g., D. pseudoobscura, D. persimilis)

    • Recombinant mt:COII from distantly related species (e.g., D. melanogaster)

    • Native mt:COII isolated from D. azteca mitochondria

    • Negative control with denatured protein

  • Functional assay controls:

    • Commercial cytochrome c oxidase as positive control

    • Enzyme activity measurements in the presence of specific inhibitors

    • Substrate titration curves to determine kinetic parameters

    • Temperature and pH stability profiles for each protein variant

  • Phylogenetic analysis controls:

    • Multiple outgroup taxa to assess root stability

    • Analyses with and without saturated sites

    • Evaluation of alternative topologies using likelihood ratio tests

    • Sensitivity analyses with different alignment algorithms

Including these controls ensures that observed differences are attributable to genuine biological variation rather than methodological artifacts or sample preparation inconsistencies.

How does the function of D. azteca mt:COII compare with homologs in other Drosophila species?

Comparative functional analysis of mt:COII across Drosophila species reveals both conservation and divergence:

  • Functional conservation:

    • Core catalytic function in electron transfer is preserved across species

    • Key structural motifs for copper binding remain conserved

    • The integration into Complex IV follows similar assembly pathways

    • Primary interaction partners (COX1, COX3) show strong conservation

  • Species-specific differences:

    • Variable kinetic parameters related to sequence differences

    • Potential adaptations to different metabolic requirements

    • Altered interactions with species-specific nuclear-encoded subunits

    • Varying sensitivities to inhibitors and environmental conditions

Studies demonstrate that both cytochrome c proteins in Drosophila can function in respiration, with transgenic expression of either cytochrome c-p or cytochrome c-d capable of rescuing lethality in cytochrome c-deficient flies. This indicates functional flexibility despite sequence divergence .

What insights can D. azteca mt:COII provide about the evolution of Complex IV across invertebrate lineages?

D. azteca mt:COII offers valuable perspectives on Complex IV evolution in invertebrates:

  • Subunit composition evolution:

    • Proteomic analysis reveals variable Complex IV composition across species

    • While mammalian COX contains 14 subunits, Drosophila shows substitution of some components

    • Novel subunits like CG7630 in D. melanogaster replace mammalian counterparts despite sequence divergence

    • Functional conservation occurs despite structural differences

  • Evolutionary patterns:

    • Core redox centers show higher conservation than peripheral subunits

    • Acquisition of additional subunits occurred throughout evolution

    • Mitochondrially-encoded subunits (like mt:COII) show different evolutionary trajectories than nuclear-encoded ones

    • Functional constraints maintain essential interactions despite sequence divergence

How does the genetic distance between D. azteca mt:COII and other species correlate with evolutionary divergence time?

The correlation between genetic distance in mt:COII and evolutionary divergence time provides insights into molecular clock calibration:

  • Variable evolutionary rates:

    • Some lineages evolve 2-3 times faster than others

    • Transitions/transversions ratios decrease with increasing genetic distance

    • Third codon positions show stronger saturation effects than first and second positions

    • This variable rate complicates molecular clock calibrations

  • Phylogenetic implications:

    • D. azteca shows closer relationship to Nearctic obscura species than expected

    • The varying rates suggest non-uniform selection pressures across lineages

    • Molecular clock assumptions may need recalibration for accurate divergence time estimation

    • Integration of fossil data with molecular estimates can improve calibration

  • Methodological considerations:

    • Bayesian relaxed clock methods can accommodate rate heterogeneity

    • Partitioned analyses allow different rates for different codon positions

    • Comparative analysis with nuclear genes can identify mitochondrial-specific rate variations

    • Accounting for saturation effects is crucial for distant relationships

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.