Recombinant Drosophila bifasciata Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To specify a tag type, please inform us, and we will prioritize its use.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila bifasciata (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITILVGYLMFMLFFNSYINRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNDIEFDS YMIPTNELSNDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTIPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNFFIKWIASKVNS
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme of the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis and transmembrane transport. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center comprising heme A3 and CuB) in subunit 1. This binuclear center reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of mt:CoII in Drosophila bifasciata?

Cytochrome c oxidase subunit 2 (mt:CoII) in D. bifasciata is encoded by the mitochondrial genome. D. bifasciata has a genome size of approximately 193 Mb, with repetitive elements constituting 30.1% of the total length. The organism harbors four large metacentric chromosomes and a small dot chromosome, with each chromosome contained in a single scaffold in recent high-quality assemblies. The mitochondrial genome contains genes for multiple subunits of cytochrome c oxidase, including mt:CoII, which functions as part of the terminal enzyme in the mitochondrial electron transfer chain .

How does mt:CoII sequence variation in D. bifasciata compare to other Drosophilids?

Sequence variation analysis of mt:CoII across Drosophilid species reveals significant genetic diversity. Studies examining mtDNA variation along altitudinal gradients have shown that most Drosophila species, including those closely related to D. bifasciata, are represented by 2-3 unique mitochondrial haplotypes, suggesting environmental heterogeneity influences genetic diversity. When comparing D. bifasciata mt:CoII with other Drosophilids, researchers should conduct multiple sequence alignments using programs like ClustalW and evolutionary distance analyses using appropriate models to determine sequence conservation patterns and evolutionary relationships .

What functions does mt:CoII serve in D. bifasciata mitochondria?

The mt:CoII protein functions as a core subunit of cytochrome c oxidase (COX), the terminal enzyme complex (Complex IV) in the mitochondrial respiratory chain. This complex catalyzes the transfer of electrons from cytochrome c to molecular oxygen, reducing it to water while pumping protons across the inner mitochondrial membrane. This activity contributes to establishing the proton gradient required for ATP synthesis. In D. bifasciata, as in other Drosophila species, mt:CoII contains copper-binding sites essential for electron transfer functions, making it critical for cellular respiration and energy production .

What are the optimal protocols for extracting high-quality mtDNA from D. bifasciata for mt:CoII analysis?

For high-quality mtDNA extraction from D. bifasciata:

  • Collect fresh or flash-frozen specimens (approximately 60 flies for optimal yields)

  • Extract using one of these methods:

    • Qiagen Blood & Cell Culture DNA Midi Kit (optimization for mitochondrial enrichment)

    • Modified phenol-chloroform extraction with differential centrifugation

  • Perform size selection for DNA fragments >15 kb using BluePippin

  • For targeted mtDNA enrichment, consider bead purification of the eluate

For optimal results, extract DNA from thoracic tissue which is rich in mitochondria. The quality of extracted DNA should be verified through gel electrophoresis and spectrophotometric analysis (A260/A280 ratio ~1.8). This methodology has been demonstrated to yield high-quality mtDNA suitable for both traditional PCR and more demanding long-read sequencing applications .

What are the recommended PCR conditions for amplifying D. bifasciata mt:CoII gene?

Based on successful amplification protocols for mitochondrial genes in Drosophilid species:

PCR Conditions for D. bifasciata mt:CoII Amplification:

Reaction Components:

  • Template DNA: 50-100 ng

  • Forward primer: 10 pmol

  • Reverse primer: 10 pmol

  • dNTPs: 200 μM each

  • MgCl₂: 1.5-2.5 mM (optimize as needed)

  • Taq DNA polymerase: 1-1.5 U

  • 1× PCR buffer

  • Total volume: 25-50 μl

Thermal Cycling Parameters:

  • Initial denaturation: 94°C for 5 min

  • 30-35 cycles of:

    • Denaturation: 94°C for 30 sec

    • Annealing: 50-55°C for 45 sec (temperature requires optimization)

    • Extension: 72°C for 1 min

  • Final extension: 72°C for 10 min

  • Hold: 4°C

Primer design should target conserved regions flanking the mt:CoII gene, with consideration for species-specific variations. Sequence data from related Drosophila species can guide primer design .

What expression systems are most suitable for producing recombinant D. bifasciata mt:CoII protein?

For functional recombinant expression of D. bifasciata mt:CoII:

Expression System Comparison:

Expression SystemAdvantagesLimitationsYield PotentialPost-translational Modifications
E. coli- Rapid growth
- High yields
- Cost-effective
- Lack of mitochondrial-specific chaperones
- No PTMs
- Inclusion body formation
HighNone
Baculovirus/Insect Cells- Native-like folding
- Supports PTMs
- Insect origin improves compatibility
- Higher cost
- Longer production time
- Technical complexity
Medium-HighYes (similar to native)
Cell-free Systems- Rapid production
- Avoids toxicity issues
- Direct incorporation of modified amino acids
- Lower yields
- Higher cost
- Limited PTMs
Low-MediumLimited
Drosophila S2 Cells- Species compatibility
- Native-like folding
- Appropriate PTMs
- Lower yields than E. coli
- Cell maintenance requirements
MediumYes (native)

Given mt:CoII's role as a membrane protein with specific folding requirements, insect cell expression systems (particularly Drosophila S2 cells) offer the most physiologically relevant environment for functional expression. For structural studies requiring higher yields, E. coli systems with solubility tags (MBP, SUMO) can be optimized, though refolding may be necessary .

How can researchers apply phylogenetic analysis to D. bifasciata mt:CoII sequences?

To conduct phylogenetic analysis of D. bifasciata mt:CoII:

  • Sequence Acquisition and Alignment:

    • Amplify and sequence mt:CoII from diverse D. bifasciata populations

    • Retrieve homologous sequences from databases

    • Perform multiple sequence alignment with MUSCLE or ClustalW

    • Trim ambiguous alignment regions

  • Evolutionary Model Selection:

    • Use ModelTest or jModelTest to determine the best-fit evolutionary model

    • For mitochondrial protein-coding genes, GTR+G+I is often appropriate

  • Tree Construction Methods:

    • Maximum Likelihood: RAxML or IQ-TREE (recommended for statistical robustness)

    • Bayesian Inference: MrBayes or BEAST (for divergence dating)

    • Neighbor-Joining: For rapid preliminary analysis

  • Statistical Support Assessment:

    • Bootstrap replication (1000 replicates minimum)

    • Bayesian posterior probabilities

  • Visualization and Interpretation:

    • Use FigTree or iTOL for tree visualization

    • Root trees with appropriate outgroups (other Drosophila species)

    • Interpret branching patterns in context of known geological events

This approach has successfully revealed evolutionary relationships among Drosophilid species in previous studies and can elucidate D. bifasciata's placement within the obscura species group .

What does mt:CoII sequence analysis reveal about D. bifasciata's evolutionary history within the obscura species group?

Analysis of mt:CoII sequences provides important insights into D. bifasciata's evolutionary history within the obscura species group:

  • Phylogenetic Placement:

    • D. bifasciata represents an important subgroup within the obscura species group

    • mt:CoII sequence analysis helps clarify relationships with other members like D. pseudoobscura and D. athabasca

  • Divergence Timing:

    • Molecular clock analyses of mt:CoII suggest divergence times

    • Evidence indicates the Muller A-AD chromosome fusion occurred approximately 15 MYA

  • Karyotype Evolution:

    • mt:CoII sequence variation correlates with chromosomal reorganization

    • The Muller C-D fusion in D. bifasciata appears to have occurred more recently than other chromosomal changes

  • Selective Pressures:

    • Tests for selection (Tajima's D, Fu and Li's F*) on mt:CoII sequences reveal patterns of molecular evolution

    • Analysis of nonsynonymous/synonymous substitution ratios can identify functionally constrained regions

This evolutionary context is essential for understanding both the conservation of metabolic functions and the adaptive changes in respiratory chain components across Drosophila species .

How can population genetic analyses of mt:CoII sequences inform understanding of D. bifasciata adaptation to different environments?

Population genetic analyses of mt:CoII sequences provide valuable insights into D. bifasciata adaptation:

  • Haplotype Diversity Measures:

    • Calculate haplotype diversity (Hd) and nucleotide diversity (π)

    • Higher diversity values often correlate with population stability or environmental heterogeneity

  • Neutrality Tests:

    • Apply Tajima's D to detect population expansion/contraction or selection

    • Use Fu's Fs and Fu and Li's F* to identify selective sweeps

    • Significant negative values suggest recent selective sweeps or population expansion

  • Altitudinal Gradient Analysis:

    • Compare mt:CoII sequences from populations at different altitudes (550m to 2700m)

    • Most Drosophila species show 2-3 unique mitochondrial haplotypes along altitudinal gradients

    • Calculate FST to quantify genetic differentiation between populations

  • Environmental Correlation:

    • Correlate sequence variations with specific environmental parameters

    • Analyze associations between haplotypes and bioclimatic variables

    • Look for amino acid substitutions that may confer adaptation to temperature extremes

  • Gene Flow Estimation:

    • Use migration rate (M) estimates between populations

    • Identify potential barriers to gene flow

These analyses can reveal how natural selection has shaped mt:CoII variation in response to environmental heterogeneity, particularly along altitudinal gradients where selective pressures on respiratory efficiency may vary significantly .

What CRISPR/Cas9 approaches are most effective for studying D. bifasciata mt:CoII function?

While CRISPR/Cas9 modification of mitochondrial DNA presents unique challenges, several strategies can be effective for studying D. bifasciata mt:CoII:

  • Nuclear-encoded mitochondrial-targeted approach:

    • Engineer recombinant mt:CoII with mitochondrial targeting sequence

    • Express from nuclear genome via CRISPR/Cas9 knock-in

    • Include mutations of interest to study functional impacts

  • MitoTALENs adaptation:

    • Design TALENs specifically targeting mt:CoII

    • Fuse to mitochondrial targeting sequences

    • More effective than standard CRISPR for mtDNA editing

  • Base editors with mitochondrial targeting:

    • Use DddA-derived cytosine base editors (DdCBEs)

    • Target specific codons without double-strand breaks

    • Particularly useful for studying specific amino acid substitutions

  • RNA interference approach:

    • Design RNA interference constructs targeting nuclear genes that interact with mt:CoII

    • Allows indirect functional assessment of mt:CoII roles

  • Heteroplasmy manipulation:

    • Introduce edited mtDNA to create heteroplasmic lines

    • Study threshold effects of mutant mt:CoII

Each approach has specific technical considerations and is best suited for particular research questions. The nuclear-encoded approach offers the most straightforward implementation but may not fully recapitulate native mt:CoII regulation .

How can proteomics approaches be applied to study interactions between recombinant D. bifasciata mt:CoII and other mitochondrial proteins?

Advanced proteomics approaches for studying mt:CoII interactions include:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Tag recombinant mt:CoII with affinity tags (FLAG, His)

    • Perform gentle solubilization with digitonin or n-dodecyl-β-D-maltoside (DDM)

    • Pull-down complexes and identify interacting partners via LC-MS/MS

    • Quantify relative abundances with label-free or isotope labeling methods

  • Proximity Labeling:

    • Fuse mt:CoII to BioID or TurboID

    • Identify proximal proteins via biotinylation

    • Particularly valuable for identifying transient interactions

  • Blue Native-PAGE with Western Blot (BN-PAGE/WB):

    • Separate intact respiratory complexes under native conditions

    • Detect mt:CoII and associated proteins via immunoblotting

    • Assess complex assembly and stability

    • Can be coupled with in-gel activity assays to correlate structure with function

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply chemical crosslinkers to stabilize protein complexes

    • Identify specific interaction sites within multiprotein assemblies

    • Generate spatial constraints for structural modeling

  • Thermal Proteome Profiling (TPP):

    • Monitor thermal stability changes of proteins in presence/absence of mt:CoII

    • Identify proteins whose stability is affected by mt:CoII interaction

These methods have successfully revealed that COX composition is functionally conserved between vertebrate and invertebrate species despite differences in individual structures .

What spectroscopic methods are most informative for analyzing the structure and function of recombinant D. bifasciata mt:CoII?

Several spectroscopic techniques provide valuable insights into mt:CoII structure and function:

  • UV-Visible Absorption Spectroscopy:

    • Characterize heme absorption features (Soret band at ~410-420 nm, α/β bands at 550-600 nm)

    • Monitor redox state changes during catalytic cycle

    • Quantify cytochrome c oxidation rates as functional readout

  • Circular Dichroism (CD) Spectroscopy:

    • Determine secondary structure composition (α-helices, β-sheets)

    • Monitor structural changes upon substrate binding or environmental perturbation

    • Assess protein folding and stability

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Directly probe copper center electronic structure

    • Characterize Cu(II) coordination environment

    • Identify changes in metal centers during catalytic cycle

  • Resonance Raman Spectroscopy:

    • Analyze heme-protein interactions

    • Detect subtle changes in metal center geometry

    • Provide insights into oxygen binding and reduction

  • Fourier Transform Infrared (FTIR) Spectroscopy:

    • Examine protein secondary structure

    • Investigate proton pumping mechanisms

    • Track conformational changes during catalysis

These spectroscopic approaches can be applied to purified recombinant mt:CoII or to mitochondrial preparations from D. bifasciata, allowing both structural and functional characterization. Each technique provides complementary information that, when integrated, offers comprehensive understanding of this essential respiratory protein .

How can researchers accurately measure the enzymatic activity of recombinant D. bifasciata mt:CoII?

Measuring enzymatic activity of recombinant mt:CoII requires these methodological approaches:

  • Polarographic Oxygen Consumption Assay:

    • Use Clark-type oxygen electrode to measure oxygen consumption rates

    • Substrate: reduced cytochrome c (typically reduced with ascorbate/TMPD)

    • Inhibitor controls: potassium cyanide (KCN) or sodium azide

    • Calculate activity as nmol O₂ consumed/min/mg protein

  • Spectrophotometric Cytochrome c Oxidation Assay:

    • Monitor absorbance decrease at 550 nm as cytochrome c is oxidized

    • Temperature control at 25°C for D. bifasciata (physiologically relevant)

    • Use extinction coefficient ε₅₅₀ = 18.5 mM⁻¹cm⁻¹

    • Calculate activity from initial velocity of absorbance change

  • In-gel Activity Assays:

    • Perform Blue Native PAGE separation of solubilized complexes

    • Overlay gel with cytochrome c and diaminobenzidine (DAB)

    • Active COX produces brown-purple precipitate

    • Quantify band intensity for semi-quantitative analysis

  • Proton Pumping Assays:

    • Reconstitute purified enzyme into liposomes

    • Monitor pH changes with pH-sensitive probes

    • Calculate H⁺/e⁻ stoichiometry

  • Respiration Measurements in Isolated Mitochondria:

    • Isolate mitochondria from D. bifasciata expressing recombinant mt:CoII

    • Measure oxygen consumption using respiratory substrates

    • Determine respiratory control ratio and ADP/O ratio

These complementary approaches provide a comprehensive functional assessment of recombinant mt:CoII activity, with the spectrophotometric and polarographic methods offering the most quantitative and reproducible results for primary activity determination .

What approaches are effective for studying the impact of D. bifasciata mt:CoII mutations on mitochondrial function?

To study the impact of D. bifasciata mt:CoII mutations on mitochondrial function:

  • Site-Directed Mutagenesis and Functional Expression:

    • Generate specific mutations in recombinant mt:CoII using site-directed mutagenesis

    • Express in heterologous systems (particularly Drosophila S2 cells)

    • Purify protein and assess enzymatic activity changes

  • Complementation Studies:

    • Express mutant mt:CoII in D. melanogaster COX-deficient cell lines

    • Measure restoration of COX activity

    • Assess rescue of cellular respiration

  • BN-PAGE Analysis:

    • Compare assembly of respiratory complexes with mutant vs. wild-type mt:CoII

    • Detect alterations in supercomplex formation

    • Identify potential assembly intermediates

  • Respiration Analysis:

    • Measure oxygen consumption in cells expressing mutant mt:CoII

    • Determine impact on maximal respiratory capacity

    • Assess coupling efficiency and reserve capacity

  • ROS Production Measurement:

    • Quantify reactive oxygen species generation using fluorescent probes

    • Determine if mutations increase electron leakage

    • Correlate with functional impairment

  • Mitochondrial Membrane Potential Assessment:

    • Use potentiometric dyes (TMRM, JC-1) to measure Δψm

    • Assess impact of mutations on proton pumping capacity

    • Correlate with bioenergetic consequences

How does the regulation of mt:CoII expression differ across developmental stages in D. bifasciata?

The regulation of mt:CoII expression across developmental stages in D. bifasciata follows patterns similar to other mitochondrial genes in Drosophila:

  • Developmental Expression Pattern:

    • Maternal contribution: High levels of mt:CoII transcripts in early embryos

    • Mid-embryogenesis: Expression predominantly in developing central nervous system

    • Larval stages: Highest expression in metabolically active tissues (muscle, gut)

    • Pupation: Dynamic changes corresponding to tissue remodeling

    • Adults: Tissue-specific expression patterns with highest levels in flight muscles

  • Tissue-Specific Regulation:

    • Central nervous system: Localized expression in specific neuronal populations

    • Imaginal discs: Expression in central regions with high metabolic demands

    • Reproductive tissues: High expression in germarium, follicular cells, nurse cells, and testes

    • Flight muscles: Exceptionally high expression due to energy demands

  • Regulatory Mechanisms:

    • Nuclear respiratory factors (NRF-1, NRF-2) coordinate nuclear and mitochondrial gene expression

    • PGC-1α homologs regulate mitochondrial biogenesis

    • Tissue-specific transcription factors fine-tune expression in different cell types

    • Post-transcriptional regulation through RNA stability and translation efficiency

  • Environmental Responsiveness:

    • Temperature adaptation: expression levels adjust to environmental temperature

    • Dietary influence: nutrient availability affects expression levels

    • Altitude adaptation: populations from different elevations show differential regulation

Understanding these regulatory patterns is essential for interpreting experimental results and designing studies that account for the dynamic nature of mt:CoII expression throughout development .

What are the most common challenges in expressing and purifying functional recombinant D. bifasciata mt:CoII?

Common challenges and troubleshooting strategies for recombinant mt:CoII work:

ChallengeCauseTroubleshooting Strategy
Poor expression levels- Toxicity to host cells
- Codon usage bias
- mRNA secondary structure
- Use inducible expression systems
- Optimize codons for expression host
- Adjust expression temperature (lower to 18-25°C)
- Try different promoter strengths
Inclusion body formation- Improper folding
- Absence of assembly partners
- Hydrophobic transmembrane regions
- Express with solubility tags (MBP, SUMO)
- Co-express with chaperones
- Use detergent-based extraction protocols
- Try insect cell expression systems
Lack of cofactor incorporation- Insufficient copper availability
- Absence of assembly factors
- Supplement media with copper
- Co-express with assembly factors
- Express in eukaryotic systems with proper assembly machinery
Poor stability after purification- Detergent effects
- Loss of lipid interactions
- Subunit dissociation
- Screen different detergents (DDM, digitonin)
- Add lipids during purification
- Use amphipols or nanodiscs for stabilization
- Optimize buffer conditions (pH, salt, glycerol)
Inactive enzyme- Improper folding
- Missing subunits
- Oxidative damage
- Verify structural integrity (CD spectroscopy)
- Reconstitute with other subunits
- Include reducing agents during purification
- Purify under anaerobic conditions

The most successful approach often involves expression in Drosophila S2 cells or baculovirus-infected insect cells, followed by gentle solubilization with n-dodecyl-β-D-maltoside (DDM) or digitonin, and purification under conditions that maintain the native lipid environment .

How can researchers optimize PCR and sequencing protocols for difficult regions of the D. bifasciata mt:CoII gene?

Optimizing PCR and sequencing for challenging regions of mt:CoII:

  • For High GC Content or Secondary Structures:

    • Add PCR enhancers: DMSO (5-10%), betaine (1-2M), or 7-deaza-dGTP

    • Use specialized polymerases (Q5 High-Fidelity, KAPA HiFi)

    • Implement touchdown PCR: Start annealing 5-8°C above optimal temperature, decrease by 0.5°C per cycle

    • Include denaturation step at 98°C rather than 94°C

  • For Homopolymer Regions:

    • Design primers to avoid poly-A/T stretches

    • Include GC clamps at primer 3' ends

    • Reduce extension temperature to 65-68°C

    • Consider specialized sequencing approaches (PacBio, Nanopore)

  • For Highly Variable Regions:

    • Design degenerate primers based on alignment of related species

    • Use nested PCR approach with outer conserved and inner variable primers

    • Increase primer length (25-30 nt) to enhance stability

  • For Long Amplicons:

    • Use long-range PCR enzymes with proofreading activity

    • Extend elongation times (1 min/kb)

    • Include additives that enhance processivity (1-2% DMSO)

    • Fragment into overlapping segments if necessary

  • For Sequencing Difficult Templates:

    • Use specialized sequencing chemistry (dGTP BigDye, dRhodamine)

    • Include sequencing enhancers (betaine, DMSO)

    • Perform cycle sequencing with higher denaturation temperature (98°C)

    • Consider next-generation sequencing approaches

These optimizations have been successfully applied to sequence mitochondrial genes across multiple Drosophila species, including those with challenging sequence contexts .

What are the best approaches for resolving conflicting phylogenetic signals when analyzing D. bifasciata mt:CoII in relation to other Drosophila species?

When confronting conflicting phylogenetic signals in mt:CoII analysis:

  • Identify Sources of Conflict:

    • Partition data by codon positions and test for congruence

    • Use likelihood-mapping or quartet puzzling to identify problematic sequences

    • Implement split networks or neighbor-net to visualize conflicting signals

    • Apply IQ-TREE's UFBoot2 to detect branches with high variance

  • Address Base Composition Bias:

    • Test for compositional heterogeneity using χ² tests

    • Apply RY-coding (purine/pyrimidine) for third codon positions

    • Use nonhomogeneous models (NDCH, nhPhyML) that account for compositional shifts

    • Consider LogDet/paralinear distance methods

  • Handle Rate Heterogeneity:

    • Implement site-heterogeneous models (CAT, C60)

    • Remove fast-evolving sites using SlowFaster or TrimAl

    • Apply relative rate tests to identify lineages with accelerated evolution

    • Use relaxed clock models to accommodate rate variation

  • Incorporate Multiple Loci:

    • Analyze mt:CoII alongside other mitochondrial and nuclear genes

    • Apply gene concordance factors (gCF) to quantify topological agreement

    • Implement multispecies coalescent methods (ASTRAL, *BEAST)

    • Use concordance analysis to identify genes with similar evolutionary histories

  • Address Incomplete Lineage Sorting:

    • Use coalescent-based methods for closely related species

    • Apply ABBA-BABA tests to detect introgression events

    • Implement MSC models that accommodate hybridization

These approaches have successfully resolved phylogenetic relationships within the Drosophila obscura species group, accounting for the complex evolutionary history reflected in mt:CoII sequences and chromosomal rearrangements .

How might structural biology approaches advance understanding of D. bifasciata mt:CoII function?

Future structural biology approaches for D. bifasciata mt:CoII research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Determine high-resolution structures of complete D. bifasciata cytochrome c oxidase

    • Compare with structures from other Drosophila species to identify structural adaptations

    • Visualize conformational changes during catalytic cycle through time-resolved cryo-EM

    • Expected outcome: 2.5-3.5Å resolution structures revealing species-specific features

  • Integrative Structural Biology:

    • Combine cryo-EM with crosslinking mass spectrometry (XL-MS)

    • Supplement with molecular dynamics simulations

    • Incorporate hydrogen-deuterium exchange mass spectrometry (HDX-MS) data

    • Expected outcome: Comprehensive understanding of dynamic structural elements

  • Membrane Protein Structural Techniques:

    • Implement lipid nanodiscs or amphipols for native-like environment

    • Apply solid-state NMR for specific structural questions

    • Use EPR spectroscopy with site-directed spin labeling

    • Expected outcome: Insights into lipid-protein interactions critical for function

  • Time-Resolved Spectroscopy:

    • Apply ultrafast spectroscopic methods to track electron transfer

    • Implement temperature-jump studies for conformational dynamics

    • Use infrared spectroscopy to monitor proton movement

    • Expected outcome: Correlation of structural changes with catalytic steps

  • Comparative Structural Analysis:

    • Compare D. bifasciata structures with those from species at different altitudes

    • Identify structural adaptations related to environmental conditions

    • Correlate with functional differences

    • Expected outcome: Understanding of structure-function relationships in adaptation

These approaches would significantly advance understanding of how structural variations in mt:CoII contribute to functional adaptations across Drosophila species and environmental conditions .

What potential applications exist for D. bifasciata mt:CoII in understanding mitochondrial disease mechanisms?

D. bifasciata mt:CoII offers valuable applications for understanding mitochondrial disease mechanisms:

  • Model System Development:

    • Generate D. bifasciata lines with mt:CoII mutations mimicking human pathogenic variants

    • Study conservation of pathogenic mechanisms across species

    • Evaluate phenotypic consequences across developmental stages

    • Expected impact: Simplified in vivo system for studying complex disease processes

  • Environmental Adaptation Insights:

    • Analyze natural variations in mt:CoII from different altitudes

    • Correlate with functional adaptations to oxygen availability

    • Apply findings to understand hypoxia response in mitochondrial diseases

    • Expected impact: New therapeutic targets for improving mitochondrial function under stress

  • Drug Screening Platforms:

    • Develop high-throughput assays using recombinant mt:CoII

    • Screen for compounds that enhance defective COX activity

    • Identify species-specific vs. conserved drug responses

    • Expected impact: Novel therapeutic candidates for mitochondrial cytochrome c oxidase deficiencies

  • Nuclear-Mitochondrial Interaction Studies:

    • Investigate nuclear compensation for mt:CoII defects

    • Identify genetic suppressors of respiratory chain deficiency

    • Apply findings to human disease contexts

    • Expected impact: New understanding of retrograde signaling pathways

  • Evolutionary Medicine Applications:

    • Compare mt:CoII variants across Drosophila species with different lifespans

    • Identify correlations between specific variants and longevity

    • Apply insights to human aging and mitochondrial decline

    • Expected impact: Novel interventions for age-related mitochondrial dysfunction

These applications leverage D. bifasciata's experimental advantages while providing translatable insights into fundamental mechanisms of mitochondrial diseases .

How might integrating genomics, transcriptomics, and proteomics advance understanding of D. bifasciata mt:CoII in ecological adaptation?

An integrated multi-omics approach to studying D. bifasciata mt:CoII in ecological adaptation:

  • Population Genomics:

    • Sequence mt:CoII from populations across environmental gradients

    • Identify variants under selection using genetic differentiation metrics

    • Correlate variant frequencies with environmental parameters

    • Expected outcome: Map of adaptively significant mt:CoII variants

  • Transcriptomics:

    • Perform RNA-Seq from different tissues across populations

    • Analyze differential expression of nuclear-encoded COX subunits

    • Identify compensatory expression changes associated with mt:CoII variants

    • Expected outcome: Understanding of transcriptional networks responding to mt:CoII variation

  • Proteomics:

    • Quantify protein abundance changes in respiratory complexes

    • Characterize post-translational modifications influenced by environment

    • Analyze protein-protein interaction networks

    • Expected outcome: Identification of adaptively significant protein modifications and interactions

  • Metabolomics:

    • Profile metabolic changes associated with different mt:CoII variants

    • Measure respiratory efficiency and ATP production

    • Characterize metabolic flexibility under environmental stress

    • Expected outcome: Linking genetic variation to metabolic phenotypes

  • Integrative Analysis:

    • Apply network analysis to connect variants to phenotypes

    • Develop predictive models of adaptive responses

    • Identify key nodes in adaptive networks

    • Expected outcome: Systems-level understanding of mt:CoII role in ecological adaptation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.