Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila erecta Serine Protease HTRA2, Mitochondrial (HtrA2)

Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2), is a recombinant protein derived from the fruit fly species Drosophila erecta. This protein is part of the HtrA family of serine proteases, which play crucial roles in maintaining mitochondrial integrity and regulating cellular stress responses. The HtrA2 protein is particularly notable for its involvement in mitochondrial function and its potential role in neurodegenerative diseases.

Production and Characteristics

The recombinant HtrA2 protein from Drosophila erecta is typically produced in either yeast or Escherichia coli (E. coli) expression systems. The choice of host organism can affect the protein's yield, purity, and post-translational modifications. For instance, yeast systems are often used for proteins requiring complex modifications, while E. coli is favored for high-yield production of simpler proteins.

Production CharacteristicsDescription
SourceYeast or E. coli
FormPartial protein, often lyophilized powder
PurityHigh purity, typically >90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C to maintain stability

Biological Function

HtrA2 proteins are known for their serine protease activity, which is essential for maintaining mitochondrial homeostasis. They are involved in the degradation of misfolded or damaged proteins within mitochondria, thus preventing oxidative stress and promoting cellular survival. In Drosophila, HtrA2 has been implicated in pathways related to stress resistance and male fertility, similar to its mammalian counterparts .

Research Findings

Research on HtrA2 in Drosophila species has highlighted its role in mitochondrial integrity and its interaction with other genes involved in neurodegenerative diseases, such as PINK1 and parkin. Studies have shown that while HtrA2 is not crucial for apoptosis, it acts in a pathway parallel to Parkin and downstream of PINK1, suggesting a complex interplay in maintaining mitochondrial function .

SpeciesFunctionInteraction
Drosophila melanogasterMaintains mitochondrial integrity, involved in stress resistance and male fertilityActs downstream of PINK1, parallel to Parkin
Drosophila erectaPresumed similar roles due to conserved HtrA2 function across speciesLikely interacts with similar pathways

Applications in Research

Recombinant HtrA2 proteins are valuable tools for studying mitochondrial biology and the mechanisms underlying neurodegenerative diseases. They can be used in biochemical assays to investigate protein-protein interactions, proteolytic activity, and the regulation of cellular stress responses.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HtrA2; GG21285; Serine protease HTRA2, mitochondrial; High temperature requirement protein A2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
75-422
Protein Length
Full Length of Mature Protein
Species
Drosophila erecta (Fruit fly)
Target Names
Target Protein Sequence
AVVSAAVIKREDFTPTIAASKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQ PITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLR IQVNNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINY LQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSA YKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPG DIVTHINKKEIKNSSDVYDALADNSKNLDIVILRGVKQMHVTITPEDP
Uniprot No.

Target Background

Function
Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2) is a serine protease exhibiting non-specific proteolytic activity against beta-casein. It promotes or induces cell death through two mechanisms: (1) direct binding and inhibition of BIRC proteins (Inhibitor of Apoptosis Proteins, IAPs), increasing caspase activity; and (2) a BIRC-independent, caspase-independent mechanism dependent on its serine protease activity. It can antagonize the anti-apoptotic activity of IAPs by directly inducing their degradation.
Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Mitochondrion intermembrane space; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Q&A

FAQs for Researchers: Recombinant Drosophila erecta Serine Protease HTRA2, Mitochondrial (HtrA2)

What is the primary biological function of HTRA2 in Drosophila erecta?

Key Functional Domains:

DomainFunctionStructural Feature
Mitochondrial Targeting Sequence (MTS)Localizes HTRA2 to mitochondriaN-terminal 1-133 residues
Serine Protease DomainExecutes proteolytic activityCatalytic triad (His, Asp, Ser)
PDZ DomainRegulates substrate binding/allosteryC-terminal domain modulates activity

Which expression systems are optimal for producing recombinant Drosophila erecta HTRA2?

  • Bacterial Expression: Use codon-optimized constructs with N-terminal His-tags for affinity purification .

  • Mitochondrial Processing: Co-express with chaperones (e.g., GroEL/ES) to ensure proper folding of the protease domain .

  • Activity Validation: Post-purification, confirm proteolytic competence using fluorogenic substrates (e.g., H2-Opt) or casein degradation assays .

How can researchers confirm the proteolytic activity of recombinant HTRA2 in vitro?

Methodology:

  • Fluorogenic Assays: Use H2-Opt substrate (Innovagen) to measure cleavage kinetics. Activity is quantified via fluorescence increase (Ex/Em: 380/460 nm) .

  • Casein Zymography: Resolve HTRA2 by non-reducing SDS-PAGE embedded with β-casein. Proteolysis manifests as clear bands post-Coomassie staining .

  • Inhibitor Controls: Include serine protease inhibitors (e.g., PMSF, UCF-101) to confirm activity specificity .

Example Data:

ConditionH2-Opt Cleavage (RFU/min)Casein Degradation (%)
WT HTRA2450 ± 3085 ± 5
S276C Mutant15 ± 510 ± 3
+ UCF-101 (30µM)20 ± 812 ± 4

Source: Adapted from

What experimental approaches resolve contradictions in HTRA2's pro-apoptotic vs. mitochondrial protective roles?

Contradictory findings arise from model-specific contexts:

  • Pro-apoptotic Role: RNAi knockdown in Drosophila larvae reduces UV-induced apoptosis, while overexpression cleaves DIAP1, triggering caspase activation .

  • Protective Role: HtrA2 null mutants exhibit mitochondrial fragmentation and sensitivity to rotenone, linking it to PINK1/Parkin-mediated mitophagy .

Resolution Strategies:

  • Tissue-Specific Knockdown: Use TH-Gal4 (dopaminergic neurons) vs. Act5C-Gal4 (ubiquitous) drivers to assess context-dependent phenotypes .

  • Stress Gradients: Titrate apoptotic stimuli (e.g., H₂O₂) to separate low-level homeostatic vs. high-level apoptotic functions .

  • Genetic Epistasis: Test HtrA2 mutants with PINK1 or parkin deletions to map pathway hierarchy .

How does HTRA2 interact with Parkinson’s disease-associated proteins like PINK1/Parkin in Drosophila models?

HTRA2 acts downstream of PINK1 but parallel to Parkin in mitochondrial quality control:

  • Phosphorylation Dependency: PINK1 phosphorylates HTRA2 at Ser142/Ser212, enhancing its protease activity .

  • Phenotypic Rescue: Co-expressing Buffy (anti-apoptotic Bcl-2 homolog) rescues locomotion defects in HtrA2 mutants, mimicking Parkin-mediated mitophagy .

Experimental Design:

  • Co-Immunoprecipitation (Co-IP): Use anti-HA/FLAG tags to pull down PINK1-HTRA2 complexes from mitochondrial lysates .

  • Phosphomimetic Mutants: Generate S142D/S212D variants to test phosphorylation-dependent activation .

What are the critical controls for RNAi-mediated HTRA2 knockdown studies?

  • Off-Target Validation: Use two independent RNAi lines (e.g., VDRC #12345, #67890) to confirm phenotype consistency .

  • Rescue Experiments: Co-express RNAi-resistant HtrA2 cDNA under UAS control .

  • Mitochondrial Markers: Include MitoTracker Red and ATP5A antibodies to distinguish apoptosis from mitochondrial dysfunction .

How to design mutagenesis studies to investigate HTRA2's dual regulatory switches?

HTRA2’s activity is regulated by N-terminal ligand binding and PDZ domain allostery . Key targets:

  • Allosteric Mutants: Delete PDZ domain (ΔPDZ) or disrupt N-terminal AVPS motif (Δ1-15) to uncouple activation steps .

  • Protease-Deficient Mutants: Replace catalytic Ser306 with Ala (S306A) to abolish enzymatic activity .

Functional Readouts:

MutantSubstrate CleavageXIAP Binding (SPR)Mitochondrial Localization
WT100%Yes (KD = 5nM)Yes
ΔPDZ220%NoYes
S306A0%YesYes
Δ1-1540%NoNo (cytosolic)

Source:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.