Recombinant Drosophila erecta Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila erecta Spastin

Spastin is a highly conserved protein that functions as a microtubule-severing enzyme across various species from Drosophila to humans. The recombinant form of Drosophila erecta Spastin enables researchers to study its properties and functions in controlled experimental settings. This protein has garnered significant scientific interest due to its evolutionary conservation and its association with hereditary spastic paraplegia (HSP) in humans, where mutations in the human SPAST gene represent the most common cause of autosomal dominant HSP . Drosophila models utilizing recombinant Spastin proteins have proven valuable for understanding the pathological mechanisms underlying this neurodegenerative disease.

The Drosophila erecta variant of Spastin shares significant structural and functional similarities with spastins from other Drosophila species and humans, making it an excellent model for comparative studies and understanding conserved cellular mechanisms. Unlike endogenous proteins, recombinant Spastin can be produced with specific tags and modifications to facilitate purification and experimental applications.

Enzymatic Classification and Biochemical Properties

Drosophila erecta Spastin is classified under the enzymatic category EC 3.6.4.3, identifying it as an ATP-dependent microtubule severing enzyme . This classification reflects its primary function of catalyzing the ATP-dependent severing of microtubules, essential components of the cellular cytoskeleton. The protein binds to microtubules and uses ATP hydrolysis to create internal breaks in the microtubule lattice, thereby regulating microtubule dynamics and organization.

Research on related Spastin proteins has demonstrated that mutation of specific residues in the AAA domain, such as the conversion of lysine to arginine at position 388 (K388R) in Drosophila melanogaster Spastin, results in complete loss of ATPase and microtubule-severing activity in vitro . This highlights the importance of specific amino acid residues for proper enzymatic function.

Microtubule Severing Activity

The primary function of Spastin is microtubule severing, which plays a crucial role in regulating cytoskeletal dynamics. Studies on Drosophila Spastin have demonstrated that overexpression in muscles erases their microtubule networks, consistent with its microtubule-severing function . This activity requires ATP binding and hydrolysis, with specific residues in the AAA domain being essential for this function.

In Drosophila neurons, Spastin regulates synaptic microtubule networks, influencing axonal and synaptic morphology . When Spastin is overexpressed in neurons, it causes axons in the embryonic central nervous system to converge onto the midline, further demonstrating its role in axonal guidance and growth . Conversely, loss-of-function mutations in Spastin result in abnormal microtubule dynamics, affecting neuronal development and function.

Role in Lipid Metabolism and Cellular Organization

Beyond its role in microtubule severing, Spastin has been implicated in lipid metabolism and organization of lipid droplets. Research has shown that Spastin can influence the size and number of lipid droplets in various tissues . Specifically, the M1 isoform of Spastin can sort from the endoplasmic reticulum to pre- and mature lipid droplets, with a hydrophobic motif comprising amino acids 57-86 being sufficient for this targeting .

Interestingly, the effects of Spastin on lipid droplets vary depending on the tissue type. In Drosophila, ubiquitous overexpression of Spastin leads to larger but fewer lipid droplets in fat bodies and increased triacylglycerol levels. In contrast, when expressed specifically in skeletal muscles or nerves, Spastin overexpression increases lipid droplet number . These findings suggest tissue-specific roles for Spastin in lipid metabolism, extending its functions beyond cytoskeletal regulation.

Recombinant Expression and Purification

While the specific expression system for commercial Recombinant Drosophila erecta Spastin is not explicitly stated in all available information, related recombinant proteins like Drosophila simulans Spastin are typically expressed in Escherichia coli (E. coli) bacterial expression systems . The production process generally involves cloning the spas gene into an expression vector, transforming bacterial cells, inducing protein expression, and purifying the resulting protein.

Models for Neurodegenerative Disorders

One of the most significant applications of recombinant Spastin proteins is in research related to hereditary spastic paraplegia (HSP). Drosophila models using Spastin have demonstrated striking behavioral similarities to human patients suffering from AD-HSP, suggesting conservation of Spastin function between the species . Remarkably, studies have shown that exogenous expression of either wild-type Drosophila or human Spastin can rescue behavioral and cellular defects in Spastin null flies equivalently .

This functional conservation has enabled the development of genetically representative models of AD-HSP, which arises from dominant mutations in Spastin rather than a complete loss of the gene. These models have been instrumental in testing observations from human pedigrees, such as the finding that S44L and P45Q mutations act as trans-acting modifiers of mutations affecting the Spastin catalytic domain .

Cytoskeletal and Cell Biology Research

Recombinant Drosophila erecta Spastin serves as an important tool for studying fundamental aspects of cell biology, particularly in relation to:

  1. Microtubule dynamics and regulation

  2. Cytoskeletal organization during cellular processes

  3. Neuronal development and synaptic formation

  4. Membrane remodeling and trafficking

  5. Lipid metabolism and lipid droplet dynamics

In experimental settings, researchers can use recombinant Spastin to manipulate microtubule networks in vitro or in vivo, allowing for detailed analysis of how microtubule severing affects various cellular processes . The ability to express wild-type or mutant forms of Spastin provides valuable insights into structure-function relationships and the consequences of specific mutations.

Comparative Analysis with Other Drosophila Species

Recombinant Drosophila erecta Spastin shares significant similarities with Spastin from other Drosophila species, particularly in functional domains responsible for ATP binding and microtubule interaction. The table below compares key characteristics of Recombinant Drosophila erecta Spastin with Recombinant Drosophila simulans Spastin:

CharacteristicDrosophila erecta SpastinDrosophila simulans Spastin
UniProt IDB3P8A3B4QSF0
Length758 amino acids758 amino acids
Gene Namespasspas
Alternative NamesSpastinSpastin, GD21056
EC Number3.6.4.3Not specified in results
Expression SystemNot explicitly specifiedE. coli
Storage BufferTris-based buffer, 50% glycerolTris/PBS-based buffer, 6% Trehalose, pH 8.0

The high degree of conservation between Spastin proteins from different Drosophila species suggests that they share many functional properties and cellular roles. This conservation extends across evolutionary distances, with functional similarities between Drosophila and human Spastin enabling cross-species rescue in experimental models .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.

Lead Time
Delivery times vary depending on shipping method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.

Synonyms
spas; GG11247; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Drosophila erecta (Fruit fly)
Target Names
spas
Target Protein Sequence
MVRTKNQSSSSSASSSSTKSPIKSSSGAGSSGGGVGGRQSTHRSSSASNVAAVVAGGSSA AGGGSSSNRRSPGSSPDGDDDTTTTDDLTPTTCSPRSGHHHTYGGYSSSVHKQNLYVVSF PIIFLFNVLRSLIYQLFCIFRYLYGASTKVIYRPHRRDCNIEIVVQNSSKEQQQSLNHPS ELSREGDGQEQQLSNQPQRFRPIQPLEMAANRPGGGYSPGPGDPLLAKQKHHHRRAFEYI SKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSM ARDRLHFLALREQDLQMQRLSLKEKPKVQAPSKPQKTREPMLAGMTNEPMKLRVRSSGYG PKATTSAQPTASGRKLTIGSKRPVNLAVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPP AVRRQFSSGRNTPPQRSRTPINNNGPSGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKV EWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATEC SATFLNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEASR RLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDEAALRRFTKRVYVSLPDEQTRELLL NRLLQKQGSPLDTEALRRLAKITDGYSGSDLTALAKDAALEPIRELNVEQVKCLDISAMR AITEQDFHSSLKRIRRSVAPQSLNSYEKWSQDYGDITI
Uniprot No.

Target Background

Function

Recombinant Drosophila erecta Spastin (spas) is an ATP-dependent microtubule-severing protein. It stimulates microtubule minus-end depolymerization and poleward microtubule flux within the mitotic spindle. Furthermore, it regulates microtubule stability at the neuromuscular junction synapse, participates in lipid metabolism by modulating lipid droplet size and distribution, and plays a role in axon regeneration through microtubule severing regulation.

Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Q&A

What is Spastin and what is its role in Drosophila?

Spastin is a microtubule-severing enzyme that plays a critical role in regulating neuronal microtubule networks. In Drosophila, Spastin functions to maintain proper microtubule dynamics, which is essential for normal neuronal development and function. Studies have shown that Spastin regulates microtubule networks by cutting microtubules to manageable sizes, facilitating their transport throughout neurons, particularly into newly forming synaptic boutons . This severing activity is crucial for maintaining appropriate microtubule length and distribution, especially at the distal ends of neurons .

Additionally, Spastin has been demonstrated to be essential for apical domain biogenesis during rhabdomere elongation in Drosophila photoreceptor morphogenesis . During pupal eye development, Spastin helps maintain the apical membrane domain as rhabdomeres grow from the distal to proximal direction .

How conserved is Spastin between Drosophila species and humans?

Drosophila Spastin shares approximately 70% amino acid identity in the catalytic AAA region with its human ortholog . While the extended amino terminus is less well conserved, both Drosophila and human Spastin share similar key regions, including the MIT (Microtubule Interacting and Trafficking) domain involved in binding microtubules and other function-related proteins .

Functional conservation has been experimentally demonstrated - exogenous expression of either wild-type Drosophila or human Spastin can rescue behavioral and cellular defects in Spastin-null flies equivalently . This suggests that despite some structural differences, the fundamental function of Spastin is highly conserved across species, including likely conservation between Drosophila melanogaster and Drosophila erecta.

What phenotypes are observed in Drosophila Spastin mutants?

Drosophila lacking Spastin exhibit several striking phenotypes that parallel symptoms seen in human AD-HSP patients:

  • Locomotor defects: Spastin-null flies walk, climb, and stand poorly, often with weak legs that slip from underneath them .

  • Developmental impacts: Complete loss of Spastin is predominantly lethal, with only some "escaper" flies surviving to adulthood with severe motor function compromise .

  • Cellular abnormalities: Mutants show fewer microtubule bundles, particularly at the distal ends of neurons .

  • Synaptic morphology changes: Spastin-null flies display smaller and more numerous boutons that are unusually clustered together .

  • Neurotransmission defects: Neurotransmitter release is impaired, and complex motor behaviors such as flying are impossible .

  • Photoreceptor development issues: Spastin mutations cause mislocalization of the apical membrane domain, which is mild at the distal section but dramatically reduced at the proximal section of developing pupal eyes .

How can Drosophila Spastin models be used to study human neurodegenerative diseases?

Drosophila Spastin models offer powerful tools for studying human neurodegenerative diseases, particularly AD-HSP, for several reasons:

Drosophila models can be genetically manipulated to:

  • Express disease-causing human Spastin mutations in a controlled genetic background

  • Create "genetically representative models" that mimic the dominant nature of human AD-HSP mutations

  • Test trans-acting modifiers identified in human pedigrees (such as S44L and P45Q)

Functional experiments have shown that flies co-expressing wild-type human Spastin and catalytic domain mutations (e.g., K388R) exhibit aberrant distal synapse morphology and microtubule distribution, similar to but less severe than Spastin nulls . This allows researchers to study different mutation mechanisms, including potential dominant-negative effects versus haploinsufficiency .

The behavioral phenotypes observed in Spastin mutant flies strikingly parallel those in humans with AD-HSP, making Drosophila particularly valuable for investigating cellular and molecular mechanisms underlying the disease pathology .

What are the technical considerations for expressing and purifying recombinant Drosophila Spastin?

When working with recombinant Drosophila Spastin:

Expression systems:

  • E. coli has been successfully used to express recombinant full-length Drosophila melanogaster Spastin with an N-terminal His tag .

  • The full protein (aa 1-758) can be expressed and purified in bacterial systems .

Storage and handling:

  • The purified protein is typically stored as a lyophilized powder .

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage at -20°C/-80°C .

  • Repeated freeze-thaw cycles should be avoided; working aliquots can be stored at 4°C for up to one week .

Purity considerations:

  • SDS-PAGE can be used to verify protein purity, which should exceed 90% for most applications .

Buffer considerations:

  • Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been used successfully for storage .

How do Spastin mutations affect microtubule dynamics in Drosophila neurons?

Spastin mutations significantly impact microtubule dynamics in Drosophila neurons through multiple mechanisms:

  • Catalytic activity disruption: The K388R mutation in Drosophila Spastin (equivalent to K388R in human Spastin) affects the residue required for nucleotide binding, causing complete loss of ATPase and microtubule severing activity in vitro .

  • Opposing effects of overexpression versus knockout:

    • Overexpression of wild-type Spastin causes dramatic collapse of the microtubule cytoskeleton and can lead to the collapse of the embryonic central nervous system .

    • Counterintuitively, Spastin knockout does not yield the opposite result - instead of excessive microtubule bundles, null mutants have fewer microtubule bundles, particularly at neuronal distal ends .

  • Altered microtubule distribution: The current model suggests that Spastin cuts microtubules to a manageable size for transport. Without Spastin, microtubule polymers may be too large to be efficiently moved into newly forming boutons, explaining the reduced microtubules at distal sites .

  • Dominant-negative effects: Some disease-causing mutations like R388 may exert dominant-negative effects, where mutant Spastin protein associates with bundled microtubules in a filamentous pattern but fails to sever them .

What are the best approaches for imaging Spastin localization and activity in Drosophila tissues?

For effective imaging of Spastin localization and activity in Drosophila tissues:

Transgenic approaches:

  • Generate GFP-tagged Spastin constructs under tissue-specific or inducible promoters (such as GAL4-UAS system) .

  • The RU486 (mifepristone)-inducible pan-neuronal system offers controlled expression for neuronal studies .

Visualization techniques:

  • For subcellular distribution in large cells, larval epidermal cells provide an excellent model due to their flat morphology .

  • Anti-GFP antibody staining of reporter-tagged Spastin allows visualization of the protein's subcellular distribution .

  • Confocal microscopy with co-staining for microtubules (using anti-α-tubulin antibodies) enables assessment of Spastin's effects on the microtubule network .

Observable patterns:

  • In larval epidermal cells, Drosophila Spastin is typically excluded from the nucleus and localizes diffusely in the cytoplasm with some aggregate formation .

  • In neurons with Spastin overexpression, look for punctate α-tubulin signal indicating microtubule fragmentation .

  • In photoreceptors, examine apical domain markers in both distal and proximal sections to assess Spastin's role in apical domain maintenance .

What genetic tools are available for studying Spastin function in Drosophila?

Several sophisticated genetic tools have been developed for studying Spastin function in Drosophila:

Null mutants and RNAi:

  • Complete Spastin null mutants are available, though most are lethal with only some "escaper" flies surviving to adulthood .

  • RNAi constructs targeting Spastin can be expressed using tissue-specific GAL4 drivers for more targeted knockdown .

Transgenic expression systems:

  • GAL4-UAS system allows tissue-specific expression of wild-type or mutant Spastin .

  • The RU486-inducible system provides temporal control over Spastin expression .

Disease model systems:

  • Transgenic flies co-expressing one copy of wild-type human Spastin and one encoding catalytic domain mutations (e.g., K388R) in the fly Spastin null background create genetically representative models of AD-HSP .

  • Trans-acting modifiers (such as S44L and P45Q) can be expressed to study genetic interactions relevant to the human disease .

Photoreceptor-specific tools:

  • The GMR-GAL4 driver allows Spastin overexpression specifically in photoreceptors to study effects on apical domain biogenesis .

How do the functional domains of Drosophila erecta Spastin compare to those in other Drosophila species and humans?

While specific information about Drosophila erecta Spastin is limited in the provided search results, we can infer likely similarities based on conservation patterns observed between Drosophila melanogaster and humans:

Rescue experiments:

  • Express human Spastin in Drosophila erecta Spastin mutants to determine if human Spastin can functionally substitute for the lost Drosophila protein .

  • Conversely, express Drosophila erecta Spastin in human cell lines with SPAST knockdown to assess complementation.

Biochemical activity assays:

  • Compare the microtubule-severing activity of purified recombinant Drosophila erecta Spastin and human Spastin in vitro .

  • Assess ATP hydrolysis rates to determine if the enzymatic properties are conserved.

Structure-function analyses:

  • Generate equivalent mutations in conserved residues (like K388R) in both Drosophila erecta and human Spastin to compare phenotypic effects .

  • Test if trans-acting modifiers identified in human pedigrees (S44L, P45Q) have similar effects when introduced into Drosophila erecta Spastin .

Subcellular localization:

  • Compare the localization patterns of GFP-tagged Drosophila erecta Spastin and human Spastin when expressed in the same cell types .

  • Examine co-localization with microtubules and other binding partners.

How can Drosophila erecta Spastin studies inform therapeutic approaches for human HSP?

Drosophila erecta Spastin studies can inform therapeutic approaches for human HSP in several key ways:

Drug screening platforms:

  • Drosophila models expressing human HSP-causing mutations can serve as platforms for small molecule screens to identify compounds that suppress motor defects or rescue cellular abnormalities .

  • The well-defined behavioral phenotypes in Spastin mutant flies (climbing defects, leg weakness) provide clear readouts for therapeutic efficacy .

Mechanistic insights:

  • Studies clarifying whether specific mutations cause disease through haploinsufficiency or dominant-negative effects can guide therapeutic strategies (gene therapy approaches versus targeting mutant protein) .

  • Understanding the precise cellular consequences of Spastin dysfunction in neurons can identify downstream pathways for therapeutic intervention .

Genetic modifier validation:

  • Identification and validation of genetic modifiers in Drosophila can uncover additional therapeutic targets .

  • The ability to test human modifiers like S44L and P45Q in flies provides a system to evaluate potential genetic interactions relevant to disease severity .

Microtubule-targeting therapies:

  • The understanding that Spastin regulates microtubule dynamics suggests that microtubule-stabilizing or destabilizing agents might compensate for Spastin dysfunction .

  • Drosophila models allow testing of such compounds in a whole-organism context before proceeding to mammalian models.

What are the key properties of recombinant Drosophila Spastin protein?

PropertyDetails for Drosophila melanogaster SpastinNotes for Research
Protein Length758 amino acids (full length)Complete protein sequence available
Molecular StructureContains MIT domain and AAA catalytic domainAAA domain highly conserved with human Spastin (~70% identity)
Expression SystemSuccessfully expressed in E. coliYields functional protein for biochemical studies
TagsN-terminal His tagFacilitates purification via metal affinity chromatography
Storage FormLyophilized powderCan be reconstituted in deionized sterile water
Recommended Storage-20°C/-80°C with 5-50% glycerolAvoid repeated freeze-thaw cycles
Buffer CompatibilityTris/PBS-based buffer, pH 8.0 with 6% trehaloseImportant for maintaining protein stability
Purity>90% as determined by SDS-PAGESuitable for most research applications
Critical ResiduesK388 required for nucleotide bindingMutation to arginine causes complete loss of ATPase activity
Subcellular LocalizationCytoplasmic with some aggregate formationExcluded from nucleus in larval epidermal cells

What are the comparative phenotypes between wild-type and Spastin-mutant Drosophila models?

Phenotypic FeatureWild-Type DrosophilaSpastin-Null DrosophilaSpastin Overexpression
ViabilityNormalPredominantly lethal with few "escapers"Variable depending on expression level
LocomotionNormal walking and climbingPoor walking, climbing; leg slippingClimbing defects when catalytically mutant Spastin is expressed
Flight AbilityNormalUnable to flyNot specifically reported
Microtubule NetworkIntact filamentous networkFewer microtubule bundles, especially at distal neuronal endsCollapse of microtubule network
Synaptic BoutonsNormal size and distributionSmaller, more numerous, and abnormally clusteredNot specifically reported
Neurotransmitter ReleaseNormalImpairedNot specifically reported
Apical Domain in PhotoreceptorsNormal maintenance during elongationMild mislocalization at distal section; dramatically reduced at proximal sectionExpansion of apical membrane domain from apical to basolateral regions
Adherens JunctionsNormal localizationNot specifically reportedSeverely expanded localization when Spastin is overexpressed
Cell PolarityNormalNot specifically reportedNo defects despite abnormal domain expansion

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.