Recombinant Drosophila erecta Vacuolar ATPase assembly integral membrane protein VMA21 (GG16118)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila erecta VMA21 (GG16118)

The recombinant Drosophila erecta vacuolar ATPase assembly integral membrane protein VMA21 (GG16118) is a full-length, His-tagged protein expressed in E. coli. It corresponds to the gene GG16118 (UniProt ID: B3NIN0) and plays a critical role in the assembly of the V₀ domain of the vacuolar H⁺-ATPase (V-ATPase) complex. This protein is essential for acidifying intracellular compartments such as lysosomes and Golgi-derived vesicles .

Functional Role in V-ATPase Assembly

VMA21 is a conserved assembly chaperone for the V₀ domain of the V-ATPase, a proton pump critical for lysosomal acidification and cellular homeostasis. Key findings include:

  • Assembly Defects: Mutations in VMA21 reduce V₀ subunit expression (e.g., ATP6V0D1, ATP6V0C) and impair interactions with ATP6AP2, leading to defective V-ATPase activity .

  • Lysosomal Dysfunction: Defective acidification disrupts autophagy, causing lipid droplet accumulation in autolysosomes and ER stress .

  • Yeast Model Validation: Human VMA21 variants rescue yeast V-ATPase function in zinc-rich environments, confirming conserved assembly mechanisms .

Research Applications

Experimental Uses of Recombinant VMA21 (GG16118):

  • Biochemical Assays: SDS-PAGE for purity validation .

  • Protein Interactions: Co-immunoprecipitation to study V₀ subunit binding .

  • Structural Studies: Limited by computational models due to low pLDDT scores .

  • ELISA Development: Used as a calibrator in immunoassays .

Cancer Research Context: While human VMA21 overexpression suppresses colorectal cancer growth, the Drosophila recombinant protein serves as a research tool to elucidate conserved V-ATPase assembly mechanisms .

Clinical and Pathological Relevance

Though the recombinant Drosophila VMA21 is not directly linked to human disease, studies on its homologs reveal:

  • X-linked Myopathy (XMEA): Hypomorphic human VMA21 mutations cause autophagic myopathy due to impaired lysosomal acidification .

  • Liver Disease: VMA21 variants in humans lead to steatosis, hypercholesterolemia, and abnormal glycosylation, highlighting its role in lipid metabolism and protein processing .

Handling and Stability

Critical Recommendations:

  • Reconstitution: Dissolve in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol to prevent degradation .

  • Stability: Lyophilized powder retains activity at -20°C/-80°C for extended periods. Repeated freeze-thaw cycles reduce efficacy .

  • Storage Buffer: Tris/PBS-based buffer with trehalose stabilizes secondary structure .

References and Diverse Sources

  1. Production and Specifications: [Creative BioMart] , [MyBioSource] , [SciCommHub] .

  2. Structural Modeling: [RCSB PDB] .

  3. Functional Studies: [PMC] , [PubMed] .

  4. Cancer Biology: [Frontiers in Oncology] .

  5. Gene Annotation: [Ensembl] .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packed with blue ice packs. If dry ice packaging is required, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
GG16118; Vacuolar ATPase assembly integral membrane protein VMA21 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-105
Protein Length
full length protein
Species
Drosophila erecta (Fruit fly)
Target Names
GG16118
Target Protein Sequence
MSTKNKKAAGGNGGAPKQTRQQSHDSQDYSSFKTVLFYCMLIVFLPVLTFFVLKGFVLDQ FLDISEVKVNIASAVGAVVALHIALGLYIYRAYFGTTGSKASKTD
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is the primary function of VMA21 in cellular physiology?

VMA21 encodes the vacuolar ATPase assembly integral membrane protein, which is essential for the assembly of V-ATPases (Vacuolar H+-ATPases). These ATP-dependent proton pumps are critical for acidifying various cellular compartments including endosomes, lysosomes, and secretory vesicles. VMA21 plays a crucial role in ensuring proper V-ATPase assembly, which directly impacts cellular functions dependent on pH regulation and compartmentalization . Specifically, VMA21 ensures the proper assembly of the integral V₀ domain that translocates protons across membranes, working in concert with the catalytic V₁ domain that hydrolyzes ATP .

How does VMA21 contribute to V-ATPase structure and assembly?

VMA21 functions as an essential assembly factor for V-ATPases, which consist of two major domains: the peripheral V₁ domain that hydrolyzes ATP, and the integral V₀ domain that translocates protons. The V₁ domain comprises eight distinct subunits (A-H) in a stoichiometry of A₃B₃CDE₃FG₃H, while the V₀ domain comprises five distinct subunits (a, c, c″, d, and e) in a stoichiometry of ac₉c″de . VMA21 specifically facilitates the assembly of these components into functional V-ATPase complexes. Without proper VMA21 function, V-ATPase assembly is compromised, leading to defects in lysosomal acidification and subsequent disruption of cellular processes dependent on pH gradients .

How do V-ATPases function at the molecular level?

V-ATPases operate through a rotary mechanism where ATP hydrolysis in the V₁ domain drives conformational changes in the hexameric arrangement of A and B subunits. This conformational change drives rotation of a central stalk composed of subunits D, F, and d, along with a proteolipid ring composed of subunits c and c″. Each proteolipid subunit contains a buried glutamate residue that becomes protonated as it rotates past the membrane-embedded C-terminal domain of subunit a. Protons enter from the cytoplasm through an aqueous hemichannel in subunit a, and the protonated glutamate residues rotate through the hydrophobic bilayer. Upon reaching another position, these residues deprotonate when stabilized by a critical arginine residue in subunit a, allowing protons to exit through a second hemichannel facing either the lumen or extracellular space .

What are effective approaches for studying VMA21 function in Drosophila erecta?

When studying VMA21 function in Drosophila erecta, researchers should consider CRISPR-Cas9 mutagenesis to generate knockout or mutant models, similar to approaches used for studying other V-ATPase components . Experimental designs should include:

  • Generation of VMA21 mutant lines using CRISPR-Cas9

  • Phenotypic characterization of mutants (morphology, behavior, survival)

  • Cellular analyses focusing on:

    • Lysosomal acidification using LysoTracker Red staining

    • Immunofluorescence for lysosomal markers like Lamp1

    • Electron microscopy to identify vacuolar abnormalities

  • Molecular analyses:

    • Western blotting for autophagy markers like LC3

    • Fluorescent reporter constructs to assess autophagic flux

These approaches can be complemented with transgenic rescue experiments to confirm phenotype specificity and structure-function studies of VMA21 .

How can I effectively express and purify recombinant Drosophila erecta VMA21 protein?

Expressing and purifying recombinant VMA21 presents specific challenges due to its integral membrane nature. A methodological approach should include:

  • Expression system selection: Consider using insect cell expression systems (Sf9 or High Five cells) that better accommodate membrane proteins compared to bacterial systems.

  • Construct design:

    • Include appropriate tags (His, FLAG, or Strep) positioned to avoid interference with protein folding

    • Consider fusion partners that enhance solubility

    • Incorporate TEV or PreScission protease sites for tag removal

  • Solubilization optimization:

    • Test multiple detergents (DDM, LMNG, digitonin) at varying concentrations

    • Consider detergent screening arrays to identify optimal conditions

    • Evaluate nanodiscs or amphipols for maintaining native-like environment

  • Purification strategy:

    • Implement two-step affinity chromatography

    • Follow with size exclusion chromatography

    • Verify protein integrity via Western blotting and mass spectrometry

Functional assays should be established to verify that the purified protein maintains its native activity, particularly regarding its ability to facilitate V-ATPase assembly .

What methods can detect alterations in VMA21-dependent lysosomal acidification?

Detection of VMA21-dependent lysosomal acidification alterations requires multiple complementary approaches:

  • Live imaging with pH-sensitive dyes:

    • LysoTracker Red staining in whole-mount preparations or cultured cells

    • Quantification of punctate staining within muscle compartments or other tissues

    • Comparative analysis between wild-type and VMA21-mutant samples

  • Immunofluorescence for lysosomal markers:

    • Double immunofluorescence for lysosome-associated membrane protein-1 (Lamp1) and tissue-specific markers

    • Quantification of fluorescence intensity in specific cellular compartments

    • Analysis of lysosomal distribution and morphology

  • Electron microscopy:

    • Identification of vacuoles with electron-dense material

    • Characterization of membrane structures within vacuoles

    • Ultrastructural analysis of lysosomal morphology

  • Biochemical approaches:

    • Subcellular fractionation and pH measurement of isolated organelles

    • Activity assays for pH-dependent lysosomal enzymes

This multi-modal approach allows comprehensive assessment of lysosomal acidification defects resulting from VMA21 dysfunction .

How do mutations in VMA21 contribute to X-linked myopathy with excessive autophagy (XMEA)?

Mutations in VMA21 lead to X-linked myopathy with excessive autophagy (XMEA) through a cascade of cellular events:

  • Primary defect: VMA21 mutations impair V-ATPase assembly, leading to defective lysosomal acidification as evidenced by the absence of LysoTracker Red staining in mutant models .

  • Lysosomal dysfunction: Reduced lysosomal acidification impairs the activity of pH-dependent lysosomal enzymes, disrupting normal protein degradation pathways.

  • Autophagy dysregulation: The compromised lysosomal function leads to aberrant autophagy, characterized by:

    • Formation of electron-dense vacuoles with naked membranes within vacuole walls

    • Increased LC3I and LC3II expression

    • Decreased LC3II/LC3I ratio, consistent with disruption of autophagic flux

    • Higher GFP:RFP ratio in fluorescent autophagy reporter constructs, indicating lower autophagic flux

  • Tissue-specific manifestations:

    • In skeletal muscle: accumulation of autophagic vacuoles and progressive weakness

    • In liver: steatosis, reduced liver size, and impaired bile flux resembling cholestatic liver phenotypes observed in patients

This pathomechanism suggests that therapeutic approaches targeting autophagy modulation may provide benefit, as demonstrated by improved survival and motor function with autophagy antagonists in animal models .

Can Drosophila erecta VMA21 models recapitulate human disease phenotypes?

Drosophila erecta VMA21 models can effectively recapitulate key features of human VMA21-associated diseases, particularly XMEA. Evidence from zebrafish models suggests similar approaches would be viable in Drosophila systems:

  • Phenotypic similarities:

    • Abnormal morphology and motor behavior paralleling human myopathy

    • Reduced survival rates

    • Muscle-specific pathology

  • Cellular pathology recapitulation:

    • Impaired lysosomal acidification (absence of LysoTracker staining)

    • Reduced lysosomal markers (Lamp1)

    • Formation of autophagic vacuoles with electron-dense material

    • Disrupted autophagic flux (altered LC3 processing)

  • Multi-system involvement:

    • Hepatic involvement (steatosis, reduced liver size)

    • Impaired bile flux (cholestatic phenotype)

  • Response to therapeutics:

    • Similar response patterns to autophagy modulators

These correlations make Drosophila erecta a valuable model organism for studying VMA21-related pathologies and potential therapeutic interventions .

FeatureHuman XMEADrosophila VMA21 KnockoutZebrafish VMA21 Knockout
Muscle weaknessExpected
Autophagic vacuolesExpected
Lysosomal acidification defectsExpected
Hepatic involvementExpected
Disrupted LC3 processingExpected
Response to autophagy modulatorsUnknownExpected

How is VMA21 function modulated by nutrient sensing pathways?

VMA21 function and V-ATPase assembly are intricately linked to nutrient sensing pathways, though with species-specific differences:

  • Nutrient-dependent assembly regulation:

    • In yeast: V-ATPase assembly increases with glucose abundance and decreases during glucose starvation, preserving ATP during nutrient limitation

    • In mammalian cells: Counterintuitively, V-ATPase assembly increases during both glucose and amino acid starvation

  • Signaling pathways involved:

    • PKA pathway: Critical for glucose-responsive assembly in yeast but not mammalian cells

    • AMPK pathway: Regulates assembly in mammalian cells during glucose starvation

    • PI3K/AKT pathway: Controls assembly in mammalian cells during glucose limitation

    • mTORC1-independent mechanisms: Regulate assembly during amino acid starvation

  • Functional consequences:

    • Different assembly states impact lysosomal acidification

    • Altered acidification affects autophagy and cellular degradation pathways

    • Changes in V-ATPase assembly influence nutrient sensing and metabolic adaptation

This dynamic regulation allows cells to respond to changing nutrient environments while maintaining essential pH-dependent cellular processes. When studying Drosophila erecta VMA21, researchers should consider these species-specific regulatory mechanisms to properly interpret results .

What is the relationship between VMA21-dependent V-ATPase assembly and autophagy regulation?

The relationship between VMA21-dependent V-ATPase assembly and autophagy regulation involves bidirectional interactions:

This reciprocal relationship creates complex regulatory circuits that maintain cellular homeostasis through precise control of degradative pathways.

How do V-ATPases contribute to endosomal function and receptor recycling?

V-ATPases, assembled with the assistance of VMA21, play crucial roles in endosomal function and receptor recycling through several mechanisms:

  • Endosomal acidification and cargo sorting:

    • V-ATPases progressively acidify early endosomes (pH ~6.5) to late endosomes (pH ~5.5)

    • This acidification induces conformational changes in internalized ligand-receptor complexes

    • The pH-dependent dissociation allows receptor recycling to the plasma membrane while targeting ligands for degradation

  • Enzyme delivery to lysosomes:

    • In late endosomes, acidification facilitates dissociation of proteases from mannose 6-phosphate receptors

    • This enables enzyme delivery to lysosomes while allowing receptor retrieval to the trans-Golgi network

  • Formation of endosomal carrier vesicles:

    • The pH gradient established by V-ATPases is required for the formation of endosomal carrier vesicles

    • These vesicles transport cargo between early and late endosomes in a pH-dependent manner

  • Regulation of signaling pathways:

    • Endosomal acidification affects the duration and intensity of receptor-mediated signaling

    • V-ATPases can modulate signaling through direct interactions with signaling components

These functions highlight the importance of properly assembled V-ATPases in maintaining endocytic trafficking and cellular signaling, with VMA21 serving as a critical factor ensuring appropriate V-ATPase assembly.

What strategies can resolve contradictory data on VMA21 function between different model systems?

When encountering contradictory data on VMA21 function between different model systems (e.g., yeast, mammalian cells, Drosophila), consider these methodological approaches:

  • Comparative functional analysis:

    • Perform parallel experiments across multiple systems under identical conditions

    • Create chimeric proteins exchanging domains between species to identify critical functional regions

    • Develop cross-species rescue experiments to test functional conservation

  • Standardized biochemical characterization:

    • Implement consistent biochemical assays for V-ATPase activity across models

    • Develop common markers of assembly state that function across species

    • Measure V-ATPase-dependent acidification using comparable methods

  • Systems-specific context evaluation:

    • Assess differences in nutrient sensing pathways that regulate V-ATPase assembly

    • Note that in yeast, assembly increases with glucose abundance, while in mammalian cells, glucose starvation increases assembly

    • Map regulatory networks in each system (e.g., PKA dependence in yeast vs. AMPK/PI3K in mammals)

  • Advanced imaging techniques:

    • Deploy super-resolution microscopy across models to resolve subcellular localization differences

    • Use FRET-based sensors to measure protein interactions in living cells

  • Omics integration:

    • Conduct comparative proteomics and transcriptomics across model systems

    • Identify species-specific interactors that may explain functional differences

Model SystemNutrient ResponseKey Regulatory PathwaysFunctional Readouts
Yeast↑ assembly with glucosePKA, RAVE complexVacuolar acidification
Mammalian cells↑ assembly with glucose starvationAMPK, PI3K/AKTLysosomal acidification
DrosophilaTo be determinedTo be determinedExpected: organelle acidification, autophagy

This comprehensive approach allows researchers to distinguish between core conserved functions and species-specific adaptations of VMA21 .

How can advanced genetic approaches be used to study VMA21 in Drosophila erecta?

Advanced genetic approaches for studying VMA21 in Drosophila erecta should leverage cutting-edge techniques while accounting for species-specific considerations:

  • CRISPR-Cas9 genome editing:

    • Design specific sgRNAs targeting VMA21 conserved domains

    • Generate precise point mutations mimicking human pathogenic variants

    • Create conditional knockouts using Flp-FRT or tissue-specific Cas9 expression

    • Implement CRISPR interference (CRISPRi) for tunable repression

  • Sophisticated transgenic approaches:

    • Utilize the Gal4-UAS system for tissue-specific expression

    • Implement deGradFP for rapid protein degradation

    • Apply split-Gal4 systems for intersectional expression patterns

    • Employ temperature-sensitive Gal80 for temporal control

  • Fluorescent reporter systems:

    • Adapt autophagy flux reporters like pTol2 (Ubbi:GFP-LC3-RFP-LC3ΔG)

    • Engineer pH-sensitive GFP fusions to monitor compartment acidification

    • Develop FRET-based sensors for protein-protein interactions

    • Create bimolecular fluorescence complementation (BiFC) constructs for interaction studies

  • Genomic considerations for D. erecta:

    • Account for potential microinjection challenges specific to D. erecta embryos

    • Consider reference genome limitations (strain 01 was used for reference genome)

    • Implement proper genetic background controls, using highly inbred lines to minimize the influence of selection

  • Cross-species complementation:

    • Test functional conservation through rescue experiments with orthologs from other species

    • Analyze evolutionary conservation of regulatory mechanisms

These approaches provide a comprehensive toolkit for dissecting VMA21 function in Drosophila erecta, enabling mechanistic insights into its role in V-ATPase assembly and cellular physiology.

What are the critical controls needed when analyzing phenotypes in VMA21 mutant models?

When analyzing phenotypes in VMA21 mutant models, implementing rigorous controls is essential for valid interpretation:

  • Genetic background controls:

    • Use multiple independent mutant lines to rule out off-target effects

    • Include heterozygous siblings as controls whenever possible

    • Generate rescue lines expressing wild-type VMA21 to confirm phenotype specificity

    • Consider using highly inbred lines to minimize genetic variation effects

  • Phenotypic analysis controls:

    • For lysosomal acidification studies:

      • Include positive controls with known V-ATPase inhibitors (bafilomycin A1)

      • Use multiple pH-sensitive dyes (LysoTracker Red, LysoSensor)

      • Quantify staining at multiple developmental timepoints

  • Autophagy assessment controls:

    • For Western blotting of LC3:

      • Include starvation-induced autophagy as positive control

      • Use autophagy inhibitors (chloroquine) to distinguish flux from initiation defects

      • Compare LC3II/LC3I ratios across multiple experimental replicates

  • Tissue-specific analyses:

    • Compare phenotypes across different tissues (muscle, liver, neurons)

    • Validate with tissue-specific markers (e.g., dystrophin for myofibers)

    • Quantify phenotypes at anatomically equivalent positions (e.g., myotendinous junctions)

  • Methodology-specific controls:

    • For electron microscopy:

      • Blind analysis by multiple observers

      • Systematic sampling of tissues

      • Quantification of vacuole frequency, size, and morphology

  • Pharmacological intervention controls:

    • Include vehicle-only treatments

    • Test multiple concentrations to establish dose-response relationships

    • Use compounds with known mechanisms of action as positive controls

This comprehensive control strategy ensures that observed phenotypes are specifically attributed to VMA21 dysfunction rather than experimental artifacts or genetic background effects.

How can researchers distinguish between direct and indirect effects of VMA21 dysfunction?

Distinguishing between direct and indirect effects of VMA21 dysfunction requires a multi-faceted experimental approach:

  • Temporal analysis of phenotype progression:

    • Implement time-course experiments to identify primary defects that appear first

    • Track the sequential appearance of phenotypes following VMA21 disruption

    • Use inducible knockout systems to observe immediate consequences of VMA21 loss

  • Molecular pathway dissection:

    • Conduct epistasis experiments by manipulating downstream pathways

    • Test if V-ATPase assembly defects precede or follow autophagy disruption

    • Implement phosphoproteomic analysis to identify early signaling changes

  • Organelle-specific assessments:

    • Measure lysosomal acidification directly using ratiometric pH indicators

    • Analyze V-ATPase assembly states biochemically

    • Evaluate lysosomal enzyme activity to confirm functional consequences

  • Rescue experiments with increasing specificity:

    • Test whether direct restoration of lysosomal pH rescues all phenotypes

    • Compare rescue efficiency of wild-type VMA21 versus mutations affecting specific interactions

    • Implement organelle-targeted expression to determine site of action

  • Interaction network mapping:

    • Perform proximity labeling (BioID, APEX) to identify direct VMA21 interactors

    • Conduct comparative interactomics between wild-type and disease-causing variants

    • Map changes in protein-protein interactions following nutrient status changes

These approaches help delineate the primary defects directly resulting from VMA21 dysfunction from the cascade of secondary consequences, providing clearer insight into disease mechanisms and potential therapeutic targets.

What technical challenges exist when studying membrane proteins like VMA21 in Drosophila systems?

Studying integral membrane proteins like VMA21 in Drosophila systems presents several technical challenges that require specific methodological considerations:

  • Protein expression and purification challenges:

    • Hydrophobic transmembrane domains complicate heterologous expression

    • Detergent selection critically affects protein stability and activity

    • Native conformation may depend on lipid environment

  • Antibody development limitations:

    • Limited exposed epitopes reduce available antibody targets

    • Cross-reactivity concerns between closely related proteins

    • Conformational epitopes may be lost during sample processing

  • Drosophila-specific technical issues:

    • Lower transformation efficiency compared to D. melanogaster

    • Potential embryo sensitivity to microinjection procedures

    • Limited commercial resources specific to D. erecta

  • Imaging challenges:

    • Membrane proteins often exhibit low signal-to-noise ratios

    • Subcellular localization may require super-resolution techniques

    • Autofluorescence of Drosophila tissues can interfere with imaging

  • Functional assays:

    • Separating assembly defects from catalytic impairments requires specialized approaches

    • Measuring organelle acidification in intact tissues demands optimized probes

    • Protein-protein interactions occur in hydrophobic environments that complicate standard interaction assays

  • Genetic manipulation considerations:

    • Complete loss-of-function may be lethal, necessitating conditional approaches

    • Compensatory mechanisms may mask phenotypes

    • Off-target effects must be rigorously controlled when using CRISPR-Cas9

Addressing these challenges requires combining biochemical, genetic, and imaging approaches, often with adaptations specific to membrane protein biology and the Drosophila model system.

How should researchers interpret conflicting data on V-ATPase assembly regulation between species?

When interpreting conflicting data on V-ATPase assembly regulation between species, researchers should consider:

  • Evolutionary divergence of regulatory mechanisms:

    • In yeast, V-ATPase assembly increases with glucose abundance

    • In mammalian cells, V-ATPase assembly counterintuitively increases during glucose starvation

    • These opposite responses likely reflect evolutionary adaptation to different metabolic demands

  • Pathway-specific differences:

    • Yeast regulation depends on the Ras/cAMP/PKA pathway

    • Mammalian regulation involves AMPK and PI3K/AKT pathways, but not PKA

    • Amino acid starvation in mammals increases assembly through mechanisms independent of PI3K or mTORC1

  • Compartment-specific regulation:

    • In yeast, only vacuolar V-ATPases (containing Vph1p) undergo glucose-dependent disassembly, while Golgi V-ATPases do not

    • This suggests subcellular specificity in regulatory mechanisms

  • Integration with other cellular processes:

    • V-ATPase assembly may be coordinated with other processes like autophagy

    • The direction of regulation may reflect different cellular priorities during nutrient stress

  • Methodological considerations:

    • Ensure equivalent experimental conditions when comparing across species

    • Consider different temporal dynamics of response between models

    • Validate assembly states using multiple complementary techniques

SpeciesEffect of Glucose AbundanceEffect of Glucose StarvationKey Regulatory PathwaysRole of PKA
YeastIncreased assemblyDecreased assemblyRas/cAMP/PKARequired
MammalsDecreased assemblyIncreased assemblyAMPK, PI3K/AKTNot involved
DrosophilaTo be determinedTo be determinedTo be determinedTo be determined

Researchers should frame their interpretations within this evolutionary context, recognizing that seemingly contradictory findings may represent adaptive specialization rather than experimental inconsistency .

What novel therapeutic approaches target VMA21-dependent pathways for disease treatment?

Emerging therapeutic approaches targeting VMA21-dependent pathways focus on several promising strategies:

  • Autophagy modulation:

    • Autophagy antagonists have shown efficacy in improving survival and motor function in VMA21 mutant models

    • Compounds like edaravone and LY294002 (PI3K inhibitor) ameliorate multiple aspects of VMA21-deficient phenotypes

    • These findings suggest a therapeutic window where partial autophagy inhibition may be beneficial

  • V-ATPase assembly stabilization:

    • Small molecules that stabilize V-ATPase assembly in the absence of functional VMA21

    • Peptide-based approaches mimicking critical VMA21 interaction domains

    • Chaperone-targeting compounds to enhance assembly of partially functional V-ATPases

  • pH restoration strategies:

    • Alternative proton transport mechanisms to compensate for V-ATPase dysfunction

    • Ionophore-based approaches for selective acidification of affected compartments

    • pH-responsive drug delivery systems targeting affected organelles

  • Gene therapy approaches:

    • AAV-mediated delivery of functional VMA21 to affected tissues

    • CRISPR-based correction of VMA21 mutations

    • Exon-skipping strategies for specific mutations

  • Metabolic interventions:

    • Targeting downstream metabolic consequences of V-ATPase dysfunction

    • Dietary modifications to reduce hepatic steatosis associated with VMA21 mutations

    • Bile acid supplementation to address cholestatic phenotypes

This multi-faceted therapeutic landscape highlights the importance of understanding the precise mechanisms of VMA21 function in V-ATPase assembly and subsequent cellular processes.

How can comparative genomics inform our understanding of VMA21 evolution across species?

Comparative genomics approaches offer valuable insights into VMA21 evolution and function:

  • Evolutionary conservation analysis:

    • Identification of highly conserved domains suggesting critical functional regions

    • Species-specific variations potentially explaining differential regulation

    • Comparative analysis of promoter regions to understand expression regulation

  • Co-evolution with V-ATPase components:

    • Correlated evolutionary changes between VMA21 and V-ATPase subunits

    • Identification of compensatory mutations maintaining protein-protein interactions

    • Mapping of species-specific adaptations in assembly factors

  • Adaptive selection signature analysis:

    • Evaluation of positive selection signatures in specific lineages

    • Identification of rapidly evolving regions suggesting adaptive specialization

    • Correlation of selection patterns with species-specific metabolism or physiology

  • Regulatory network evolution:

    • Comparison of V-ATPase assembly regulation between species

    • Divergence in nutrient sensing pathways controlling assembly (e.g., PKA in yeast vs. AMPK/PI3K in mammals)

    • Evolution of compartment-specific regulation mechanisms

  • Experimental validation approaches:

    • Cross-species complementation to test functional conservation

    • Domain swapping experiments to identify species-specific functional elements

    • Reconstruction of ancestral sequences to track evolutionary trajectories

This evolutionary perspective provides context for understanding species-specific differences in VMA21 function and regulation, facilitating more accurate translation between model systems and human disease.

What computational approaches can predict the impact of VMA21 mutations on protein function?

Advanced computational approaches for predicting the impact of VMA21 mutations include:

  • Structural prediction and analysis:

    • Ab initio modeling or homology modeling of VMA21 structure

    • Molecular dynamics simulations to assess mutation effects on protein stability

    • Protein-protein docking with V-ATPase components to identify critical interaction interfaces

  • Sequence-based prediction tools:

    • Ensemble methods combining multiple prediction algorithms

    • Conservation analysis across evolutionarily diverse species

    • Specific transmembrane protein-focused prediction tools

  • Network-based approaches:

    • Analysis of mutation impact on protein interaction networks

    • Identification of network perturbations using interactome data

    • Pathway enrichment analysis to predict broader cellular consequences

  • Machine learning integration:

    • Deep learning algorithms trained on membrane protein datasets

    • Feature extraction from multiple data types (structure, sequence, expression)

    • Supervised learning approaches using known pathogenic mutations as training data

  • Experimental validation pipeline design:

    • Computational prioritization of mutations for functional testing

    • In silico design of compensatory mutations for validation experiments

    • Prediction of mutation-specific cellular phenotypes for targeted assays

These computational approaches should be combined with experimental validation to establish a robust pipeline for assessing VMA21 variants and their potential pathogenicity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.