Recombinant Drosophila erecta Zinc finger protein-like 1 homolog (GG12524)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Drosophila erecta Zinc finger protein-like 1 homolog (GG12524) is a protein that, like other zinc finger proteins, functions as a transcription factor . These proteins play critical roles in transcriptional regulatory networks in metazoan genomes . GG12524, also known as Zinc finger protein-like 1 homolog, is produced using an in vitro E. coli expression system.

Characteristics

  • Source: Drosophila erecta (Fruit fly)

  • Synonyms: GG12524; Zinc finger protein-like 1 homolog

  • Protein Length: Full length protein, consisting of 298 amino acids

  • Tag Info: Tag type is determined during the manufacturing process

  • Form: Lyophilized powder

  • Buffer Before Lyophilization: Tris/PBS-based buffer, 6% Trehalose

  • Storage Condition: Store at -20°C/-80°C upon receipt. Avoid repeated freeze-thaw cycles and aliquot for multiple uses.

  • Reconstitution: Reconstitute in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C is recommended.

  • Subcellular Location: Membrane; Single-pass membrane protein

  • Protein Families: ZFPL1 family

Function and Significance

Zinc finger proteins (ZFPs) constitute the largest group of transcription factors in higher metazoans . Characterizing these ZFPs and their target sequences is crucial for annotating transcriptional regulatory networks .

Drosophila ZFPs have been studied to understand their DNA-binding specificities, utilizing bacterial one-hybrid systems to identify recognition motifs and predict genomic binding sites . Studies have shown that a single Drosophila zinc finger protein can specify 47 of the 64 possible DNA triplets .

One study showed that Kipferl, a ZAD zinc-finger protein, guides Rhino to G-rich motifs present in piRNA-producing loci in Drosophila . Kipferl's two ZnF arrays are predicted to bind DNA with a specificity for guanosine-rich motifs, and the sequence motifs enriched in Kipferl ChIP-seq peaks closely matched in silico predictions for Kipferl’s ZnF arrays .

Production and Usage

Recombinant GG12524 is produced in vitro using an E. coli expression system. It is commonly supplied as a lyophilized powder and should be reconstituted according to the manufacturer's instructions before use. The protein is shipped with ice packs to maintain its stability during transportation.

Database Information

DatabaseLink
UniProtB3P7K6
KEGGder:Dere_GG12524

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
GG12524; Zinc finger protein-like 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-298
Protein Length
full length protein
Species
Drosophila erecta (Fruit fly)
Target Names
GG12524
Target Protein Sequence
MGLCKCPKRLVTNQFCFEHRVNVCEHCMVQSHPKCIVQSYLQWLRDSDYISNCTLCGTTL EQGDCVRLVCYHVFHWDCLNARQAALPANTAPRGHQCPACTVEIFPNANLVSPVADALKS FLSQVNWGRNGLGLALLSEEQNSLKAIKPKVASQSAVSNMTKVHHIHSGGERERTKPNGH DAVSPHSVLLMDAFNPPSAGDYASSRRPLLPRQSPIGGTDRDDNKYQRRTPAELFSRWTR RFYAPSSRPPWRRTWFLVTAGILAFVLFVYLMAWLGRGGSDAVDEGWNNPNPQPNHYE
Uniprot No.

Target Background

Database Links
Protein Families
ZFPL1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • How can I determine the DNA binding specificity of GG12524?

Defining the DNA recognition motifs for GG12524 requires multiple complementary approaches:

  • High-throughput binding assays:

    • Bacterial one-hybrid (B1H) screening, which has successfully identified recognition motifs for other Drosophila zinc finger proteins

    • SELEX (Systematic Evolution of Ligands by Exponential Enrichment) with deep sequencing to define comprehensive binding preferences

    • Protein-binding microarrays with diverse DNA sequences

  • In vivo genomic approaches:

    • ChIP-seq to identify actual genomic binding sites in Drosophila erecta cells

    • CUT&RUN or CUT&Tag for higher resolution mapping of binding locations

    • Integration with chromatin accessibility data (ATAC-seq) to correlate binding with open chromatin

  • Computational prediction:

    • Based on the protein sequence, particularly the zinc finger domains, computational tools can predict potential DNA binding motifs

    • For example, Kipferl's ZnF arrays were predicted to bind DNA with specificity for guanosine-rich motifs, and ChIP-seq peaks closely matched these in silico predictions

  • What is the evolutionary significance of GG12524 in the Drosophila lineage?

Understanding GG12524's evolution requires examining it within the broader context of Drosophila genome evolution:

  • Lineage-specific patterns: The fraction of the genome associated with transcriptional regulation in Drosophila can be unusually dynamic, with higher-than-average rates of protein divergence and gene expression evolution . Zinc finger proteins often show lineage-specific expansions.

  • Phylogenetic context: Studies of the D. melanogaster species complex (including D. erecta) reveal widespread incongruence in nucleotide and amino acid substitutions, insertions and deletions, and gene trees . This suggests incomplete lineage sorting has affected many genes, potentially including GG12524.

  • Methodological approach:

    • Compare GG12524 orthologs across Drosophila species to identify conserved domains and variable regions

    • Calculate dN/dS ratios to detect signatures of positive selection

    • Perform synteny analysis to understand chromosomal context evolution

    • Conduct population genetic analyses within D. erecta to detect recent selective sweeps

  • How does GG12524 potentially contribute to transcriptional regulatory networks?

Based on knowledge of related zinc finger proteins, GG12524 likely participates in transcriptional networks through several mechanisms:

  • Direct transcriptional regulation: As a zinc finger transcription factor, GG12524 likely binds specific DNA sequences in promoters or enhancers to activate or repress gene expression.

  • Chromatin modification recruitment: Similar to how Kipferl guides Rhino to G-rich motifs in piRNA-producing loci , GG12524 may recruit chromatin-modifying enzymes to specific genomic regions.

  • Experimental investigation approaches:

    • RNA-seq following GG12524 knockdown/knockout to identify regulated genes

    • ChIP-seq for GG12524 combined with ChIP-seq for histone modifications to identify correlations

    • Protein interaction studies to identify cofactors and chromatin modifiers

    • Reporter gene assays to validate direct transcriptional effects

    • 3C/4C/Hi-C to assess effects on chromatin architecture

  • What role might GG12524 play in Drosophila erecta biology and adaptation?

While the specific biological role of GG12524 is not fully characterized in the search results, we can draw inferences based on related zinc finger proteins and evolutionary patterns:

  • Potential specialization: D. erecta shows host plant-driven sensory specialization compared to sibling species . Transcription factors like GG12524 may contribute to such adaptations by regulating gene expression networks involved in sensory perception.

  • Reproductive biology: Many zinc finger proteins in Drosophila are involved in reproductive functions. For example, Trem is critical for meiotic recombination , and genes associated with male reproduction in Drosophila show particularly dynamic evolution .

  • Investigation approach:

    • Expression profiling across tissues and developmental stages

    • Phenotypic analysis of GG12524 mutants, particularly focusing on sensory systems and reproduction

    • Comparative analysis with close relatives like D. yakuba to identify D. erecta-specific patterns

    • Integration with ecological data on D. erecta habitat preferences and behaviors

  • How do zinc finger domains in GG12524 contribute to its molecular function?

The zinc finger domains in GG12524 are central to its function as a transcription factor:

  • DNA recognition mechanism: Each C2H2 zinc finger typically contacts 3-4 nucleotides of DNA, with the combination and arrangement of multiple fingers enabling recognition of extended sequences. Studies show that a single Drosophila zinc finger protein can specify up to 47 of the 64 possible DNA triplets.

  • Domain architecture significance:

    • The arrangement of zinc fingers determines binding specificity

    • Linker regions between fingers can affect DNA binding affinity and specificity

    • Mutations in either finger domains or linkers can alter function

  • Experimental evidence from related proteins: Studies of Trem, another zinc finger protein, showed that mutations in different zinc finger domains led to varying defects in meiotic function. Mutations in the zinc finger domains of Trem increased meiotic nondisjunction, suggesting these domains are essential for proper DNA binding and function .

  • Structure-function analysis approach:

    • Generate systematic mutations in each zinc finger domain

    • Assess effects on DNA binding specificity

    • Analyze changes in target gene regulation

    • Perform domain swapping with related zinc finger proteins

  • How can I design knockdown/knockout experiments to study GG12524 function?

Effective genetic manipulation of GG12524 requires careful experimental design:

  • CRISPR/Cas9 approach:

    • Design sgRNAs targeting conserved regions of GG12524, particularly the zinc finger domains

    • Include appropriate controls (non-targeting sgRNAs)

    • Verify knockout efficiency through sequencing and protein detection

    • Create precise point mutations to alter specific functional domains rather than complete knockouts

  • RNAi approach:

    • Design dsRNAs targeting unique regions of GG12524 to avoid off-target effects

    • Use inducible or tissue-specific expression systems for temporal and spatial control

    • Validate knockdown efficiency using qRT-PCR and western blotting

  • Phenotypic analysis:

    • Examine effects on transcription of potential target genes

    • Analyze developmental phenotypes, particularly in tissues where GG12524 is expressed

    • Assess DNA binding profiles through ChIP-seq in wild-type vs. mutant backgrounds

    • Perform rescue experiments with wild-type and mutant versions of GG12524

  • Caveats and considerations:

    • Potential compensatory mechanisms by related zinc finger proteins

    • Developmental lethality if GG12524 has essential functions

    • Need for tissue-specific or inducible systems if constitutive knockout is lethal

  • What techniques can identify protein interaction partners of GG12524?

Identifying the interactome of GG12524 requires multiple complementary approaches:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged GG12524 in Drosophila cells or tissues

    • Perform immunoprecipitation under native conditions

    • Identify co-precipitating proteins by mass spectrometry

    • Validate interactions through reciprocal IP and co-localization

  • Proximity-based methods:

    • BioID approach: Fuse GG12524 to a biotin ligase to biotinylate proximal proteins

    • APEX2 approach: Fuse GG12524 to an engineered peroxidase for proximity labeling

    • These methods capture both stable and transient interactions

  • Yeast two-hybrid screening:

    • Use full-length or domain-specific baits

    • Screen against Drosophila cDNA libraries

    • Validate interactions in more physiological contexts

  • Functional genomics correlation:

    • Compare phenotypes of GG12524 mutants with other known mutants

    • Identify genes with similar expression patterns

    • Analyze genetic interactions through double-mutant analysis

  • How might post-translational modifications affect GG12524 function?

While specific post-translational modifications (PTMs) of GG12524 aren't described in the search results, zinc finger proteins are often regulated by various PTMs:

  • Common modifications and functional consequences:

    ModificationTypical SitesFunctional Effects
    PhosphorylationSer/Thr/Tyr residuesAlters DNA binding affinity, protein interactions, localization
    SUMOylationLys residuesRegulates transcriptional activity, often repressive
    AcetylationLys residuesAffects DNA binding, protein stability
    UbiquitinationLys residuesRegulates protein turnover, sometimes signaling
  • Investigation methodology:

    • Mass spectrometry analysis of purified GG12524 to identify PTMs

    • Generation of modification-specific antibodies

    • Creation of mutants at predicted modification sites (phospho-null, phospho-mimetic)

    • Analysis of PTM patterns under different cellular conditions

    • Identification of enzymes responsible for adding/removing modifications

  • Functional assessment:

    • Compare DNA binding properties of modified vs. unmodified protein

    • Examine nuclear localization and chromatin association

    • Assess protein stability and turnover rates

    • Analyze effects on protein-protein interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.