Recombinant Drosophila grimshawi Adenosine monophosphate-protein transferase FICD homolog (GH10751)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Drosophila grimshawi Adenosine monophosphate-protein transferase FICD homolog (GH10751) is a protein that belongs to the FICD homolog family and is found in the fruit fly Drosophila grimshawi . It is involved in the transfer of adenosine monophosphate to other proteins . The recombinant form of this protein is produced using genetic engineering techniques, where the gene encoding GH10751 is inserted into a host organism (e.g., E. coli) to produce large quantities of the protein .

Basic Information

FeatureDescription
NameRecombinant Full Length Drosophila grimshawi Adenosine monophosphate-Protein Transferase Ficd Homolog (Gh10751) Protein, His-Tagged
SourceE. coli
SpeciesDrosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Protein LengthFull Length (1-483 amino acids)
TagHis-Tag (N-terminal)
PurityGreater than 90% as determined by SDS-PAGE
FormLyophilized powder
SynonymsGH10751; Protein adenylyltransferase Fic; De-AMPylase Fic
UniProt IDB4JBN5
Gene NameGH10751
StorageStore at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles .
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionCentrifuge the vial briefly before opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% of glycerol (final concentration) for long-term storage .

Function and Significance

  • Adenosine Monophosphate-Protein Transferase Activity Adenosine monophosphate-protein transferase FICD homolog (GH10751) functions as a protein adenylyltransferase, catalyzing the transfer of an AMP moiety to target proteins . This post-translational modification can alter the activity, localization, or interaction of the target protein .

  • Relevance to Drosophila Biology In Drosophila, FICD homologs are involved in various biological processes, including neuronal development and function, signaling pathways, and responses to environmental stimuli .

  • Potential Research Applications Recombinant GH10751 can be used in biochemical assays to study its enzymatic activity, identify target proteins, and investigate the regulatory mechanisms in which it participates . It can also be employed in structural studies to understand the molecular basis of its function.

Production and Quality Control

Recombinant GH10751 is typically produced in E. coli and purified using affinity chromatography, such as His-tag purification . Quality control measures include SDS-PAGE to assess purity and ensure that the protein is at least 85-90% pure . Proper storage and handling are crucial to maintain the protein's integrity and activity .

Uses

  • Biochemical Assays: Studying enzymatic activity and identifying target proteins.

  • Structural Studies: Understanding the molecular basis of its function.

  • Drug Discovery: Screening for inhibitors or activators of GH10751.

  • Understanding Diapause: Investigating genes associated with successful diapause in Drosophila .

  • Pesticide Transporter Studies: Comprehensive characterization of pesticide transporters in Drosophila melanogaster .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
GH10751; Protein adenylyltransferase Fic; De-AMPylase Fic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-483
Protein Length
full length protein
Species
Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Target Names
GH10751
Target Protein Sequence
METGKVTQEPKQMKFTYRFAFFFIAGSLATFVFHALTSSSSVSLFGWRLQLRQLHHLPTA HYLQTRDEFAVYSVDELNAFKEFYDKSVSDSVGASYTEAEQTNIKEALGAMRLALDMHIS GKDDKAARLFEHALALAPKHPEVLLRYGEFLEHNQRNIVLADQYYFQALSISPSNSEAFA NRQRTANVVQTLDERRLVSLDEKRDALSAIHEANAALRRAKKEAYFQHIYHSVGIEGNTM TLAQTRSVLETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKLEITLKDILELHRRVLG HVDPIEGGEFRRTQVYVGGHVPPGPGDLALLMQRFEHWLNSEQSNSLHPVNYAALAHYKL VHIHPFIDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSQYYHFLKLANEGDIRPFVRFIA DCTEKTLDLYLWATSDLPQQIPMLIQTESEGGVLAQLQSHIAQSAPEPYESGSGLDSGVN GMP
Uniprot No.

Target Background

Function

This protein functions as a dual-acting enzyme, mediating both the addition (AMPylation) and removal (de-AMPylation) of adenosine 5'-monophosphate (AMP) to/from target proteins. The Glu-236 residue dictates its activity as either an adenylyltransferase (AMPylation) or a phosphodiesterase (de-AMPylation). It plays a crucial regulatory role in the unfolded protein response (UPR) by modulating the AMPylation/de-AMPylation state of Hsc70-3/BiP. Under normal cellular conditions, it AMPylates Hsc70-3/BiP at Thr-518, thus inactivating it. Conversely, under endoplasmic reticulum stress, it removes the AMP moiety (de-AMPylation) from Hsc70-3/BiP at Thr-518, restoring HSPA5/BiP activity.

Database Links
Protein Families
Fic family
Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.