Recombinant Drosophila grimshawi Spastin (spas)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila grimshawi Spastin (spas)

Recombinant Drosophila grimshawi Spastin (spas) refers to a genetically engineered version of the Spastin protein derived from the species Drosophila grimshawi. Spastin is a microtubule-severing protein that plays a crucial role in maintaining microtubule dynamics, which are essential for various cellular processes, including cell division, axon outgrowth, and synaptic function. While specific information on Drosophila grimshawi Spastin is limited, insights from other Drosophila species and human studies provide valuable context for understanding its potential functions and applications.

Background on Spastin

Spastin is encoded by the SPG4 gene in humans and is closely related to the microtubule-severing protein Katanin. Mutations in the SPG4 gene are the most common cause of autosomal dominant hereditary spastic paraplegia (AD-HSP), a neurodegenerative disorder characterized by progressive weakness and spasticity of the legs . In Drosophila, Spastin has been shown to regulate synaptic microtubule networks and is essential for normal neuromuscular junction (NMJ) function and locomotor activity .

Microtubule Severing and Regulation

  • Microtubule Dynamics: Spastin in Drosophila acts as a microtubule-severing enzyme, which is crucial for maintaining the dynamic state of microtubules necessary for cellular processes such as axon outgrowth and synaptic function .

  • Synaptic Function: Alterations in Spastin levels affect synaptic microtubule stability, impacting neurotransmission and synaptic growth .

Role in Photoreceptor Morphogenesis

  • Spastin is also involved in the development of photoreceptors in Drosophila, where it regulates the apical membrane domain during rhabdomere elongation .

Potential Applications of Recombinant Drosophila grimshawi Spastin

Recombinant Spastin proteins can be used in various research applications, including:

  • Studying Microtubule Dynamics: Recombinant Spastin can be used to study microtubule severing mechanisms in vitro.

  • Modeling Neurodegenerative Diseases: Given its role in AD-HSP, recombinant Spastin can help model and study neurodegenerative diseases in Drosophila models.

  • Therapeutic Targets: Understanding the function of Spastin can provide insights into potential therapeutic targets for treating AD-HSP and other microtubule-related disorders.

Research Findings and Data

While specific data on Drosophila grimshawi Spastin is limited, studies on other Drosophila species provide valuable insights:

SpeciesFunctionPhenotype
Drosophila melanogasterMicrotubule severing, synaptic regulationNMJ defects, locomotor impairment
Drosophila melanogasterPhotoreceptor morphogenesisApical domain defects

References Society for Developmental Biology. (2025). Spastin. PLOS ONE. (2010). Role of Spastin in Apical Domain Control along the Rhabdomere. PubMed. (2004). Drosophila spastin regulates synaptic microtubule networks and is. PMC. (2004). Drosophila Spastin Regulates Synaptic Microtubule Networks and Is. PMC. (2010). Functional conservation of human Spastin in a Drosophila model of. PMC. (2006). Recognition of C-terminal amino acids in tubulin by pore loops in. PLOS Biology. (2004). Drosophila Spastin Regulates Synaptic Microtubule Networks and Is. Cusabio. Recombinant Drosophila simulans Spastin (spas), partial. Society for Developmental Biology. (n.d.). Spastin.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
spas; GH18484; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-782
Protein Length
full length protein
Species
Drosophila grimshawi (Fruit fly) (Idiomyia grimshawi)
Target Names
spas
Target Protein Sequence
MVRTKNQSSSSSASSSTKSPVKISGGTTNRSRSCSDALIDDGNSKSSSKPTSNNRQRTTT NNNTTAITTTPGSSPDNDDDDTTTTDADLTPTSGNAPRGGNSSVHKQNLYVVSFPIIFLF NVLRSLIYQLFCIFRYLYGASTKVIYRSPNRRDCNIEIVVQNSKEQQQQHQHQQAIIHCP LERRGNISGIEQTLAQALPQRQRAIQPLEMAGNRAGGNYSPGPGDPLLAKQKHHHRRAFE YISKALKIDEENEGHKELAIELYRKGIKELEDGIAVDCWSGRGDVWDRAQRLHDKMQTNL SMARDRLHFLALREEDLQLQRLSLKEQQQKKKSPQQQPQQQQQHTFKQPMLVGQTNSSGG SGSTKVPLRSSGYGLKPSATNISRAMPAASGRKLTIGNKRPGNLPVVNKSQTLPRNLGSK TSSTSVGAALQRQPGKTAATPPAVRRQFSSGRNTPPQRSRTPINNNAAGGSGSGASTPMV SVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPA KGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRALFAVARHMQP SIIFIDEVDSLLSERSSNEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLAATNRPQELDE AALRRFTKRVYVSLPDVQTRELLLNRLLQKQGSPLDSDALGRLAKITEGYSGSDLTALAK DAALEPIRELNVEQVKCLDISAMRQITEKDFHNSLKRIRRSVAPQSLNSYEKWSQDYGDI TI
Uniprot No.

Target Background

Function
Recombinant Drosophila grimshawi Spastin (spas) is an ATP-dependent microtubule-severing protein. It stimulates microtubule minus-end depolymerization and poleward microtubule flux in the mitotic spindle. Furthermore, it regulates microtubule stability in the neuromuscular junction synapse, participates in lipid metabolism by modulating lipid droplet size and distribution, and plays a role in axon regeneration through microtubule severing regulation.
Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Chromosome. Lipid droplet.

Q&A

What is the basic structure and function of Drosophila Spastin?

Drosophila Spastin is a microtubule-severing enzyme belonging to the AAA (ATPases Associated with diverse cellular Activities) protein family. The full-length protein consists of 758 amino acids in D. melanogaster and contains conserved domains including an N-terminal region and a highly conserved C-terminal AAA ATPase catalytic domain .

Functionally, Spastin regulates microtubule dynamics by severing microtubules into manageable fragments. This activity is critical for proper neuronal development and function. When expressed at appropriate levels, Spastin helps maintain the proper size of microtubule polymers for efficient transport throughout neurons. The protein requires ATP binding and hydrolysis for its microtubule-severing activity, with the catalytic domain being essential for this function .

How conserved is Spastin between Drosophila species and humans?

Spastin is highly conserved across Drosophila species and shows significant conservation with human Spastin. The D. melanogaster Spastin shares identical domain organization with human Spastin, with approximately 21% identity and 44% similarity at the amino acid level . This conservation extends to functional properties, as demonstrated by rescue experiments where human Spastin can functionally substitute for Drosophila Spastin in null mutants .

The most conserved region is the AAA ATPase catalytic domain, particularly the ATP-binding region containing the Walker A and B motifs. The high degree of conservation suggests that findings from Drosophila species can provide valuable insights into human Spastin function and dysfunction in neurological disorders .

What phenotypes are associated with Spastin mutations in Drosophila?

Spastin mutations in Drosophila produce several distinct phenotypes at cellular, behavioral, and molecular levels:

Neuronal/Synaptic Phenotypes:

  • Reduced number of microtubule bundles, particularly at the distal ends of neurons

  • Smaller and more numerous synaptic boutons that appear abnormally clustered

  • Altered synaptic morphology and neurotransmitter release

Behavioral Phenotypes:

  • Impaired motor function and flying ability

  • Tendency to drag hind legs, similar to human HSP symptoms

  • Reduced climbing ability in adults (null mutants show ~42% reduction in vertical climbing distance)

Cellular/Molecular Phenotypes:

  • Abnormal microtubule distribution and stability

  • Progressive neurodegeneration in adult brains, manifested as vacuolization

  • Apoptotic neuronal cell death in aged flies

The severity of these phenotypes can vary depending on the specific mutation and genetic background, showing parallels to the variable expressivity observed in human HSP patients .

What are the optimal conditions for expressing and purifying recombinant Drosophila Spastin?

Recombinant Drosophila Spastin can be successfully expressed and purified under the following conditions:

Expression System:

  • E. coli is the preferred expression system for full-length Drosophila Spastin

  • The protein is typically fused to an N-terminal His-tag to facilitate purification

Expression and Purification Protocol:

  • Transform expression vector containing Spastin cDNA into E. coli

  • Induce protein expression with IPTG at optimal temperature (typically 18-25°C to enhance solubility)

  • Lyse cells and purify using nickel affinity chromatography

  • Further purify using size exclusion chromatography if needed

  • The final product is typically obtained as a lyophilized powder

Storage Conditions:

  • Store lyophilized powder at -20°C/-80°C

  • For reconstituted protein, add glycerol (final concentration 5-50%, optimally 50%) and store in aliquots at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as they may compromise protein activity

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution:

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

How can I assess the ATPase and microtubule-severing activities of recombinant Spastin in vitro?

ATPase Activity Assay:

  • Prepare reaction mixture containing purified Spastin, ATP, and appropriate buffer

  • Incubate at 37°C for defined time intervals

  • Measure inorganic phosphate release using malachite green or similar colorimetric assays

  • Calculate ATPase activity as mol Pi released per mol protein per minute

  • Include controls: no-enzyme control, catalytically inactive mutant (e.g., K388R equivalent)

Microtubule-Severing Assay:

  • Prepare fluorescently labeled microtubules (typically using rhodamine-labeled tubulin)

  • Immobilize microtubules on glass coverslips

  • Add purified Spastin protein with ATP and buffer

  • Monitor microtubule severing in real-time using fluorescence microscopy

  • Quantify severing activity by measuring the decrease in microtubule fluorescence intensity or by counting severing events over time

  • Compare with positive controls (known active microtubule-severing proteins) and negative controls (catalytically inactive mutants)

Key Parameters to Assess:

  • ATP dependence: Compare activity with and without ATP

  • Concentration dependence: Test various Spastin concentrations

  • Kinetics: Determine the rate of microtubule severing

  • Substrate specificity: Test different microtubule preparations (e.g., dynamic vs. stable)

What genetic tools are available for studying Spastin function in Drosophila?

Several genetic tools are available for studying Spastin function in Drosophila:

Mutant Lines:

  • Null alleles: Generated through imprecise excision of P-elements (e.g., spastin 5.75 allele)

  • Point mutations: Engineered mutations corresponding to human disease-causing variants

Transgenic Lines:

  • UAS-Spastin: For GAL4-driven overexpression of wild-type Spastin

  • UAS-Spastin-K388R: Catalytically inactive mutant (equivalent to human K388R)

  • UAS-CFP/Venus-tagged Spastin: Fluorescently labeled Spastin for visualization

  • UAS-human Spastin: For expressing human Spastin variants in flies

GAL4 Driver Lines:

  • elav-GAL4: For pan-neuronal expression

  • elav-GS-GAL4: GeneSwitch system for inducible neuronal expression

  • 24B-GAL4: For muscle-specific expression

  • Various tissue/cell-specific GAL4 lines for targeted expression

CRISPR/Cas9 Tools:

  • For generating precise mutations or tagged variants at the endogenous locus

Compound Genotypes:
Modular genetic systems allow creation of complex genotypes that mimic human disease states, such as:

  • Heterozygous point mutations

  • Compound heterozygotes with different mutations

  • Trans-heterozygotes with deletion and point mutation

How effective is Drosophila as a model system for studying human Hereditary Spastic Paraplegia (HSP) caused by SPAST mutations?

Drosophila has proven highly effective as a model system for studying HSP caused by SPAST mutations, offering several advantages:

Phenotypic Similarities:

  • Drosophila spastin mutants exhibit progressive locomotor defects reminiscent of HSP symptoms, including leg dragging and reduced climbing ability

  • The neurodegeneration pattern observed in aged flies parallels aspects of human HSP pathology

Genetic Conservation:

  • The functional domains of Spastin are highly conserved between flies and humans

  • Human Spastin can functionally substitute for Drosophila Spastin in rescue experiments, demonstrating functional conservation

Allelic Representation:

  • Various allelic combinations can be generated in flies to model different human HSP genotypes:

    • Heterozygous loss-of-function (haploinsufficiency model)

    • Dominant negative mutations (e.g., K388R equivalent)

    • Compound heterozygous mutations

Quantifiable Readouts:

  • Multiple phenotypic parameters can be quantitatively assessed:

    • Behavioral: Climbing assays, flight tests

    • Cellular: Synaptic morphology, microtubule distribution

    • Molecular: Apoptosis markers, protein interactions

Limitations:

  • Differences in nervous system complexity between flies and humans

  • Some human-specific modifiers may be absent in Drosophila

  • Potential differences in protein interactions and regulatory mechanisms

What is the relationship between Spastin mutations and microtubule dynamics in neurodegenerative processes?

The relationship between Spastin mutations and microtubule dynamics in neurodegeneration is complex and bidirectional:

Effects of Spastin Loss on Microtubules:

  • Spastin null mutations lead to reduced microtubule severing, resulting in fewer but potentially longer microtubule bundles

  • This disrupts the balance of microtubule dynamics, particularly in distal neuronal regions

  • Altered microtubule stability affects axonal transport and synaptic growth

Synaptic Consequences:

  • Reduced Spastin function leads to abnormal bouton morphology and distribution

  • Synaptic boutons become smaller and more numerous with aberrant clustering

  • Neurotransmitter release is impaired, affecting neural circuit function

Progressive Neurodegeneration:

  • Age-dependent accumulation of brain vacuoles in spastin mutants

  • Progressive neuronal apoptosis detected by TUNEL and caspase-3 staining

  • Neurodegeneration correlates with worsening motor dysfunction over time

Therapeutic Implications:

  • Microtubule-targeting drugs can modify phenotypes in Drosophila models

  • Treatment with microtubule-destabilizing agent vinblastine (1 μM) rescues both behavioral defects and neuronal survival in spastin mutants

  • This suggests that restoring microtubule dynamics balance, rather than simply increasing or decreasing stability, may be key to therapeutic approaches

Pathway Integration:

  • Spastin functions within a broader network of microtubule regulators

  • Interacts with BMP-dFMRP-Futsch pathway in controlling synaptic growth

  • Cross-talk with endocytic pathways through interaction with Eps15

This relationship highlights how precise regulation of microtubule dynamics is essential for neuronal health, and how disruption of this balance contributes to progressive neurodegeneration.

How do different mutations in Spastin affect protein function and disease severity?

Different mutations in Spastin have distinct effects on protein function and disease severity, which can be categorized as follows:

Mutation TypeEffect on ProteinCellular ConsequenceDisease SeverityDrosophila Phenotype
Null mutationsComplete loss of proteinAbsence of microtubule severingVariable, often severe in homozygotesReduced microtubule dynamics, abnormal bouton morphology, severe motor defects
Catalytic domain mutations (e.g., K388R)Loss of ATPase activityInactive protein that may bind microtubulesSevere when dominant negativeMicrotubule bundling, reduced severing activity
Missense mutations outside catalytic domainVariable effects on protein stability/functionPartial loss of functionVariable, often milderIntermediate phenotypes depending on mutation
Compound heterozygous mutationsComplex combined effectsDepends on specific mutationsOften more severe than single heterozygotesCan be modeled with multiple transgenes

Molecular Mechanisms:

  • Haploinsufficiency: Some mutations reduce Spastin protein levels, leading to insufficient microtubule-severing activity. Evidence includes the absence of truncated proteins in patients with early termination codons .

  • Dominant Negative: Mutations like K388R may produce proteins that bind microtubules but cannot sever them, potentially interfering with wild-type Spastin function. These mutants show filamentous association with bundled microtubules rather than severing them .

  • Gain of Toxic Function: Some mutations may confer novel toxic properties to the protein beyond loss of normal function.

Genotype-Phenotype Correlations:

  • The age of onset and progression rate correlate with mutation type

  • Missense mutations in the AAA domain often produce earlier onset than frameshift/truncating mutations

  • Compound heterozygotes for S44L and other mutations show earlier disease onset and increased severity

Drosophila models recapitulate these patterns, with flies expressing human Spastin variants showing phenotypic severity that correlates with human clinical presentations .

How can evolutionary comparisons of Spastin across Drosophila species inform understanding of protein function?

Evolutionary comparisons of Spastin across Drosophila species provide valuable insights into protein function and conservation:

Conservation Analysis:

  • Comparing Spastin sequences from D. melanogaster, D. grimshawi, and other Drosophila species reveals evolutionarily conserved regions that likely play critical functional roles

  • The AAA ATPase catalytic domain shows the highest conservation, highlighting its fundamental importance for Spastin function

  • Variable regions may indicate species-specific adaptations or regions under less selective pressure

Structure-Function Relationships:

  • Correlating sequence conservation with known functional domains helps identify critical amino acid residues

  • Naturally occurring variations between species can reveal which residues are tolerant to substitution

  • This information can help interpret the potential pathogenicity of human variants

Species-Specific Adaptations:

  • Differences in Spastin between Drosophila species may reflect adaptations to different environmental niches or developmental patterns

  • For example, species with different neuronal architecture might show subtle variations in microtubule-regulatory domains

  • These adaptations could provide insights into the evolution of microtubule regulation in different nervous systems

Experimental Applications:

  • Generate chimeric proteins containing domains from different Drosophila species to identify functionally interchangeable regions

  • Test cross-species rescue ability (e.g., whether D. grimshawi Spastin can rescue D. melanogaster spastin nulls)

  • Compare interaction partners of Spastin across species to identify conserved and divergent molecular pathways

Such comparative approaches can reveal functionally critical domains and residues that might be targeted in therapeutic strategies for human HSP caused by SPAST mutations.

What are the optimal experimental designs for studying Spastin interactions with other microtubule-regulating proteins?

To effectively study Spastin interactions with other microtubule-regulating proteins, researchers should consider these experimental approaches:

In Vitro Interaction Studies:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of Spastin and potential interacting proteins

    • Perform pull-down with antibodies against tags or specific proteins

    • Analyze co-precipitated proteins by western blotting

    • This approach has successfully identified Eps15-Spastin interactions

  • GST Pull-down Assays:

    • Express GST-fusion proteins of potential interacting partners

    • Incubate with purified Spastin or cell lysates expressing Spastin

    • Analyze bound proteins by western blotting or mass spectrometry

    • Example: GST-Eps15ΔN successfully pulled down HA-Spartin, while mutants lacking the Eps15-binding domain failed to interact

  • Microtubule Competitive Binding Assays:

    • Set up reactions with purified microtubules and Spastin

    • Add potential competing proteins at varying concentrations

    • Measure changes in Spastin's microtubule-binding or severing activity

In Vivo Interaction Studies:

  • Fluorescence Resonance Energy Transfer (FRET):

    • Express fluorescently tagged Spastin (e.g., CFP) and potential partners (e.g., Venus)

    • Measure FRET signals in live cells or tissues

    • Example: UAS-CFP-Spastin and Venus-tagged partner proteins can be co-expressed in specific tissues

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein assay where reconstitution indicates protein interaction

    • Particularly useful for visualizing where in the cell interactions occur

  • Genetic Interaction Analysis:

    • Cross spastin mutants with mutations in genes encoding potential interactors

    • Analyze whether phenotypes are enhanced (synergistic) or suppressed

    • Example: Analysis of interactions between spastin and futsch mutations

Advanced High-throughput Approaches:

  • Proximity-dependent Biotin Identification (BioID):

    • Fuse Spastin to a biotin ligase

    • Identify proteins in close proximity through biotinylation and streptavidin pull-down

    • Analyze by mass spectrometry

  • Quantitative Interactome Analysis:

    • Use stable isotope labeling (SILAC) combined with IP-MS

    • Compare wild-type Spastin interactome with mutant variants

    • Identify differential interactions that might explain pathogenic mechanisms

Controls and Validation:

  • Include catalytically inactive Spastin mutants (e.g., K388R equivalent)

  • Use domain deletion mutants to map interaction regions

  • Confirm interactions through multiple independent techniques

  • Validate functional relevance through phenotypic rescue experiments

How can microscale thermophoresis and other biophysical techniques be applied to study Spastin-microtubule interactions?

Advanced biophysical techniques offer powerful approaches to characterize Spastin-microtubule interactions with high precision:

Microscale Thermophoresis (MST):

  • Principle: Measures changes in molecule movement along microscopic temperature gradients based on size, charge, and hydration shell

  • Application to Spastin:

    • Label either Spastin or microtubules with fluorescent dye

    • Create serial dilutions of the unlabeled binding partner

    • Apply temperature gradient and monitor thermophoretic movement

    • Calculate binding constants (Kd) from concentration-dependent changes in thermophoresis

  • Advantages:

    • Requires small sample volumes (few μL)

    • Works in solution without immobilization

    • Can determine binding affinities in near-native conditions

    • Suitable for analyzing how mutations affect binding kinetics

Surface Plasmon Resonance (SPR):

  • Application:

    • Immobilize microtubules on sensor chip surface

    • Flow Spastin solutions at various concentrations over the surface

    • Measure real-time association and dissociation

    • Determine kon, koff, and equilibrium dissociation constants

  • Insights: Can reveal how different Spastin mutations affect not just binding strength but association/dissociation kinetics

Isothermal Titration Calorimetry (ITC):

  • Application:

    • Measure heat changes when Spastin binds to microtubules

    • Determine thermodynamic parameters (ΔH, ΔS, ΔG)

    • Calculate binding stoichiometry and affinity

  • Value: Provides complete thermodynamic profile of the interaction without labeling

Total Internal Reflection Fluorescence (TIRF) Microscopy:

  • Application:

    • Immobilize fluorescently labeled microtubules on glass surface

    • Add fluorescently labeled Spastin

    • Monitor real-time binding, diffusion, and severing events

  • Advanced analysis:

    • Single-molecule tracking to determine residence times

    • Analyze processive vs. distributive severing mechanisms

    • Measure severing rates as function of Spastin concentration

Analytical Ultracentrifugation (AUC):

  • Application:

    • Analyze sedimentation behavior of Spastin-microtubule complexes

    • Determine complex stoichiometry and assembly state

    • Assess how mutations affect complex formation

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

  • Application:

    • Expose Spastin to deuterated buffer with and without microtubules

    • Analyze exchange patterns to identify binding interfaces

    • Compare wild-type and mutant Spastin to locate conformational changes

  • Insight: Provides structural information about the interaction interface without requiring crystallization

These techniques, used in combination, can provide comprehensive characterization of how wild-type and mutant Spastin variants interact with microtubules, offering molecular-level insights into disease mechanisms.

How do post-translational modifications regulate Spastin activity in different cellular contexts?

Post-translational modifications (PTMs) play critical roles in regulating Spastin activity across different cellular contexts:

Phosphorylation:

  • Multiple serine and threonine residues in Spastin can be phosphorylated

  • Phosphorylation may regulate catalytic activity, subcellular localization, or protein-protein interactions

  • Kinases implicated in Spastin regulation include Cyclin-dependent kinases (CDKs) and mitotic kinases

  • Research question: How does phosphorylation status change during neuronal development and in response to cellular stress?

Ubiquitination:

  • Regulates Spastin protein stability and turnover

  • May target specific Spastin pools for proteasomal degradation

  • Research question: Do disease-causing mutations affect ubiquitination patterns and protein half-life?

SUMOylation:

  • May influence Spastin's interactions with microtubules or binding partners

  • Research question: How does SUMOylation affect Spastin's severing activity in different subcellular compartments?

Acetylation:

  • Could regulate Spastin interaction with tubulin, which itself is subject to acetylation

  • Research question: Is there cross-talk between tubulin acetylation and Spastin activity?

Methodological Approaches:

  • Mass Spectrometry:

    • Identify PTM sites on wild-type and mutant Spastin

    • Quantify PTM changes in different cellular conditions

  • Phospho-specific Antibodies:

    • Monitor Spastin phosphorylation states in different tissues or developmental stages

    • Track changes in response to neuronal activity or stress

  • Mutagenesis Studies:

    • Generate phosphomimetic (S/T → D/E) or phospho-dead (S/T → A) mutations

    • Assess effects on Spastin localization, activity, and protein interactions

  • Kinase/Phosphatase Inhibitors:

    • Treat cells or flies with specific inhibitors to modulate Spastin phosphorylation

    • Evaluate consequences for microtubule dynamics and neuronal function

Understanding the complex PTM landscape of Spastin could reveal new therapeutic targets for modulating its activity in HSP and other neurodegenerative conditions.

What role does Spastin play in non-neuronal tissues and how might this inform therapeutic approaches?

While Spastin's role in neurons is well-characterized, its functions in non-neuronal tissues are increasingly recognized as important:

Muscle:

  • Spastin regulates microtubule dynamics in muscle tissue

  • Expression using muscle-specific drivers (e.g., 24B-GAL4) affects microtubule organization

  • Research question: Does muscle-specific dysfunction contribute to HSP motor symptoms?

Glia:

  • Spastin may regulate glial microtubule dynamics, affecting neuron-glia interactions

  • Research question: How does glial Spastin function affect neuronal health and survival?

Dividing Cells:

  • Spastin localizes to the mitotic spindle and midbody during cell division

  • May regulate microtubule dynamics during cytokinesis

  • Research question: How do Spastin mutations affect cell division in proliferating tissues?

Endocytic Pathways:

  • Spastin interacts with endocytic and trafficking proteins like Eps15

  • May regulate membrane trafficking and endosomal functions

  • Research question: How does Spastin contribute to receptor trafficking and signaling?

Therapeutic Implications:

  • Tissue-Specific Targeting:

    • Developing neuron-specific therapies may avoid side effects from interfering with Spastin in other tissues

    • Alternatively, targeting shared pathways in both neurons and muscles might provide synergistic benefits

  • Differential Susceptibility:

    • Understanding why long motor neurons are particularly vulnerable to Spastin mutations

    • Identifying protective mechanisms that prevent pathology in other cell types

  • Compensatory Mechanisms:

    • Exploring how non-neuronal tissues compensate for Spastin dysfunction

    • Leveraging these mechanisms for therapeutic development

Experimental Approaches:

  • Tissue-Specific Knockdown/Rescue:

    • Use tissue-specific GAL4 drivers to manipulate Spastin in defined cell populations

    • Assess autonomous and non-autonomous effects

  • Cell Type-Specific Transcriptomics:

    • Compare gene expression changes in different tissues following Spastin manipulation

    • Identify tissue-specific response pathways

  • Ex Vivo Tissue Culture:

    • Isolate different tissues from spastin mutants

    • Test tissue-specific responses to potential therapeutic compounds

Comprehensive understanding of Spastin's multi-tissue functions will inform more targeted and effective therapeutic strategies for HSP and related disorders.

How can CRISPR-based approaches be optimized for studying Spastin function and for developing therapeutic strategies?

CRISPR-based approaches offer powerful tools for both studying Spastin function and developing potential therapeutics:

Research Applications:

  • Precise Genome Editing:

    • Generate knock-in models of specific human disease mutations

    • Create reporter lines with fluorescently tagged endogenous Spastin

    • Introduce conditional alleles for temporal control of Spastin expression

  • Base and Prime Editing:

    • Introduce point mutations without double-strand breaks

    • Test effects of specific amino acid changes on Spastin function

    • Create isogenic cell lines differing only in Spastin variants

  • CRISPRi/CRISPRa Systems:

    • Modulate Spastin expression levels without altering the gene sequence

    • Study dose-dependent effects relevant to haploinsufficiency models

    • Identify compensatory pathways activated when Spastin is depleted

  • CRISPR Screening:

    • Conduct genome-wide or targeted screens for genetic modifiers of Spastin phenotypes

    • Identify enhancers or suppressors of Spastin-associated neurodegeneration

    • Discover potential therapeutic targets

Therapeutic Development:

  • Allele-Specific Targeting:

    • Design CRISPR systems to selectively suppress dominant negative mutant alleles

    • Spare wild-type allele expression in heterozygous patients

    • Challenge: Designing highly specific gRNAs that discriminate between alleles differing by single nucleotides

  • Gene Correction:

    • Repair pathogenic mutations in patient-derived cells

    • Potential for ex vivo correction and cell transplantation therapies

    • Challenge: Delivery to post-mitotic neurons in the central nervous system

  • Activation of Compensatory Pathways:

    • Use CRISPRa to upregulate genes that can compensate for Spastin deficiency

    • Target microtubule regulators that could restore balance

    • Example targets: other microtubule-severing proteins like Katanin or Fidgetin

Optimization Strategies:

  • Delivery Methods:

    • AAV vectors optimized for neuronal targeting

    • Blood-brain barrier-penetrating nanoparticles

    • Cell-penetrating peptides fused to Cas proteins

  • Temporal Control:

    • Inducible CRISPR systems to study developmental vs. maintenance roles

    • Optogenetic or chemical control of CRISPR activity

  • Specificity Enhancement:

    • High-fidelity Cas variants to minimize off-target effects

    • Paired nickase approaches for increased specificity

    • Careful gRNA design with comprehensive off-target prediction

Drosophila as a Testing Platform:

  • Rapid generation of multiple CRISPR-engineered variants

  • In vivo testing of allele-specific targeting strategies

  • Evaluation of phenotypic rescue by compensatory pathway activation

CRISPR technologies provide unprecedented precision for both mechanistic studies and therapeutic development in the context of Spastin-related disorders, with Drosophila serving as an efficient initial testing platform before translation to mammalian models.

What are the most promising therapeutic strategies targeting Spastin or microtubule dynamics for treating HSP?

Based on current research, several promising therapeutic strategies emerge for treating HSP through targeting Spastin or microtubule dynamics:

Microtubule-Targeting Agents:

  • Low-dose microtubule-destabilizing drugs (e.g., vinblastine) have shown promise in Drosophila models

  • Treatment with 1 μM vinblastine rescued both behavioral defects and neuronal survival in spastin mutant flies

  • Challenge: Finding the optimal balance of microtubule stabilization/destabilization for therapeutic benefit without toxicity

Gene Therapy Approaches:

  • AAV-mediated delivery of wild-type Spastin to neurons

  • Allele-specific silencing for dominant negative mutations

  • Gene editing to correct specific mutations

  • Challenge: Delivery to the correct neuronal populations in the spinal cord

Small Molecule Modulators:

  • Compounds that enhance residual Spastin activity in haploinsufficiency cases

  • Molecules that promote alternative microtubule-severing pathways

  • Challenge: Achieving specificity for target pathways

Targeting Downstream Pathways:

  • Enhancing axonal transport mechanisms compromised by Spastin deficiency

  • Protecting neurons from degeneration through anti-apoptotic interventions

  • Challenge: Identifying the most critical downstream effectors

Combination Therapies:

  • Microtubule-targeting drugs plus neuroprotective agents

  • Gene therapy plus small molecule enhancers

  • Challenge: Optimizing synergistic effects while minimizing adverse interactions

Emerging Approaches:

  • RNA-based therapeutics to modulate Spastin expression

  • Proteostasis modulators to enhance protein folding or clearance

  • Neuronal activity modulators to reduce excitotoxicity

The most effective strategies will likely vary depending on the specific SPAST mutation and disease mechanism (haploinsufficiency vs. dominant negative). Drosophila models provide valuable platforms for comparative testing of these approaches before progression to mammalian models and clinical trials.

How can systems biology approaches integrate Spastin research with broader neurodegeneration mechanisms?

Systems biology approaches offer powerful frameworks for integrating Spastin research with broader neurodegeneration mechanisms:

Multi-omics Integration:

  • Combine transcriptomic, proteomic, and metabolomic data from Spastin models

  • Identify common pathways disrupted across different neurodegenerative conditions

  • Example: Compare differential expression profiles between Spastin models and other microtubule-related neurodegeneration models

Network Analysis:

  • Construct protein-protein interaction networks centered on Spastin

  • Identify hub proteins that connect Spastin to other neurodegeneration pathways

  • Map how microtubule disruption cascades through cellular systems

Comparative Disease Modeling:

  • Analyze phenotypic similarities between Spastin-related HSP and other neurodegenerative conditions

  • Identify shared cellular mechanisms (e.g., axonal transport defects appear in multiple conditions)

  • Leverage Drosophila's genetic tractability to create combination models (e.g., Spastin+Tau or Spastin+Parkin)

Temporal Dynamics Analysis:

  • Study age-dependent progression of pathology in Spastin models

  • Compare with temporal trajectories in other neurodegenerative conditions

  • Identify early vs. late pathological events to distinguish causes from consequences

Cross-Species Integration:

  • Compare Drosophila Spastin data with mouse, zebrafish, and human patient data

  • Identify evolutionarily conserved and divergent response patterns

  • Develop predictive models of therapeutic responses across species

Machine Learning Applications:

  • Train algorithms to identify subtle phenotypic patterns across neurodegeneration models

  • Predict potential drug efficacy based on multi-dimensional data signatures

  • Discover new connections between seemingly unrelated pathways

Therapeutic Implications:

  • Identify common therapeutic targets across multiple neurodegenerative conditions

  • Discover opportunities for drug repurposing

  • Develop combinatorial therapeutic strategies addressing multiple pathological mechanisms

By adopting systems approaches, researchers can place Spastin dysfunction within the broader context of neurodegeneration, potentially revealing unexpected connections and novel therapeutic strategies that might be overlooked by more reductionist approaches.

What are the key unanswered questions about Spastin that future research should prioritize?

Despite significant advances in Spastin research, several critical questions remain unanswered and should be prioritized in future investigations:

Molecular Mechanism Questions:

  • What is the precise structural mechanism by which Spastin severs microtubules, and how do disease mutations disrupt this process?

  • How is Spastin activity regulated in different subcellular compartments and developmental stages?

  • What is the complete interactome of Spastin in neurons, and how does it change under stress conditions?

  • How do post-translational modifications dynamically regulate Spastin function?

Cell Biology Questions:

  • What determines the specificity of Spastin for certain microtubule populations?

  • How does Spastin cooperate with other microtubule-severing proteins like Katanin and Fidgetin?

  • What is the relationship between Spastin and tubulin post-translational modifications?

  • How does Spastin function in non-neuronal tissues, and why are neurons particularly vulnerable to its dysfunction?

Disease Mechanism Questions:

  • What explains the selective vulnerability of specific neuronal populations in HSP?

  • Why is there such variable expressivity among patients with identical SPAST mutations?

  • How do Spastin mutations lead to progressive neurodegeneration over decades?

  • What compensatory mechanisms operate in asymptomatic carriers of SPAST mutations?

Therapeutic Development Questions:

  • Which disease mechanism (haploinsufficiency vs. dominant negative) predominates in different SPAST mutations?

  • Can microtubule-targeting drugs be optimized to achieve therapeutic benefits without toxicity?

  • What is the optimal timing for intervention in presymptomatic mutation carriers?

  • How can gene therapy approaches be optimized for delivery to relevant neuronal populations?

Comparative and Evolutionary Questions:

  • How has Spastin function evolved across species, and what can this tell us about its fundamental roles?

  • What explains the differences in phenotypic severity between Drosophila, mouse, and human Spastin mutations?

  • Are there natural genetic modifiers that explain variable expressivity in human populations?

Addressing these questions will require interdisciplinary approaches combining structural biology, advanced imaging, genetic manipulation, and clinical studies. Drosophila models will continue to play a vital role in answering many of these questions, particularly when integrated with mammalian models and human patient data.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.