Recombinant Drosophila lowei Cytochrome c oxidase subunit 2 (mt:CoII)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Drosophila lowei Cytochrome c Oxidase Subunit 2 (mt:CoII)

Recombinant Drosophila lowei Cytochrome c Oxidase Subunit 2 (mt:CoII) is a mitochondrial-encoded protein produced using recombinant DNA technology. It is a critical component of Complex IV (cytochrome c oxidase, COX) in the electron transport chain, facilitating the reduction of oxygen to water during oxidative phosphorylation . This recombinant variant is expressed in Escherichia coli (E. coli), fused with an N-terminal polyhistidine (His) tag for purification, and provided in lyophilized powder form .

Functional Role in Mitochondrial Respiration

mt:CoII directly transfers electrons from cytochrome c to the catalytic binuclear center (heme a3-CuB) in COX subunit 1 (mt:CoI), enabling oxygen reduction to water . This process drives proton pumping across the mitochondrial membrane, contributing to the electrochemical gradient for ATP synthesis .

Mutational Studies and Pathological Insights

  • COII G177S Mutation: A hypomorph in Drosophila melanogaster mt:CoII (Gly177→Ser) reduces COX activity by ~20% at 29°C, impairing male fertility due to defective sperm development .

  • COX VIa Mutations: Disruption of nuclear-encoded COX subunits (e.g., levy mutants) causes mitochondrial encephalomyopathy, neurodegeneration, and motor dysfunction in Drosophila .

Comparative Analysis With Orthologs

FeatureDrosophila lowei mt:CoII Drosophila melanogaster mt:CoII
Expression SystemE. coliMammalian cells
TagHis tagUndetermined (varies by production batch)
Purity>90%>85%
Storage Stability12 months (lyophilized)6–12 months (liquid/lyophilized)

Applications in Research

  • Enzyme Activity Assays: Used to study COX function and inhibition in mitochondrial disorders .

  • Structural Biology: Facilitates crystallographic studies of COX assembly and electron transfer mechanisms .

  • Hybrid Fitness Studies: Models interpopulation hybrid breakdown due to COX2-cytochrome c incompatibilities .

Recombinant Production Workflow

  1. Gene Cloning: Full-length mt:CoII (UniProt P29860) cloned into E. coli expression vectors.

  2. Fermentation: High-density bacterial cultures induced for protein expression.

  3. Purification: Immobilized metal affinity chromatography (IMAC) via His tag .

  4. Quality Assurance:

    • SDS-PAGE for purity validation (>90%).

    • Mass spectrometry for sequence confirmation.

Evolutionary and Ecological Implications

  • Sequence Divergence: mt:CoII exhibits high interpopulation amino acid variability in marine copepods (Tigriopus californicus), driven by compensatory evolution with nuclear-encoded COX subunits .

  • Conservation: The CuA-binding loop (residues 196–204) is universally conserved across metazoans, underscoring its functional indispensability .

Future Directions

  • Therapeutic Targeting: Screen for small molecules modulating COX2 activity in mitochondrial diseases.

  • Hybrid Breakdown Mechanisms: Elucidate epistatic interactions between mt:CoII and nuclear-encoded electron transport chain subunits .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt:CoII; CoII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Drosophila lowei (Fruit fly)
Target Names
mt:CoII
Target Protein Sequence
MSTWANLGLQDSASPLMEQLIFFHDHALLILVMITVLVGYLMFMLFFNSYVNRFLLHGQL IEMIWTILPAIILLFIAMPSLRLLYLLDEINEPSITLKSIGHQWYWSYEYSDFNNVEFDS YMIPTNELSNDGFRLLDVDNRIVLPMNSQIRILVTAADVIHSWTVPALGVKVDGTPGRLN QTNFFINRPGLFYGQCSEICGANHSFMPIVIESVPVNYFIKWISSTVNS
Uniprot No.

Target Background

Function
Drosophila lowei Cytochrome c oxidase subunit 2 (mt:CoII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain. This enzyme drives oxidative phosphorylation by participating in a series of complexes (complex II, CII; complex III, CIII; and complex IV, CIV) that transfer electrons from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, fueling transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) formed by heme A3 and copper B (CuB) in subunit 1. The BNC then uses four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Drosophila lowei Cytochrome c oxidase subunit 2 (mt:CoII) and what is its function?

Drosophila lowei Cytochrome c oxidase subunit 2 (mt:CoII) is a mitochondrial protein that functions as a critical component of the cytochrome c oxidase (COX) complex, which is the terminal enzyme in the electron transport chain. This 229-amino acid protein (P29860) plays an essential role in cellular respiration by facilitating electron transfer from cytochrome c to molecular oxygen . The protein is encoded by the mitochondrial genome and contributes to the catalytic core of the COX complex. As part of this complex, mt:CoII helps maintain the proton gradient necessary for ATP synthesis, thus being crucial for cellular energy production. While mt:CoII's primary function relates to respiration, research on Drosophila cytochrome c proteins suggests potential additional roles in cellular processes such as apoptosis .

How is Recombinant Drosophila lowei mt:CoII typically expressed and purified?

The recombinant production of Drosophila lowei mt:CoII typically employs bacterial expression systems, with E. coli being the predominant host. The standard methodology involves:

  • Cloning the full-length mt:CoII gene (coding for amino acids 1-229) into an expression vector

  • Adding an N-terminal His-tag to facilitate purification

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under optimized conditions

  • Lysing cells and purifying using nickel affinity chromatography

The commercially available recombinant protein is expressed in E. coli with an N-terminal His-tag . This approach allows for high-yield production of the protein for functional and structural studies. For researchers developing their own expression systems, codon optimization for E. coli is recommended, as mitochondrial genomes often use slightly different codon preferences than the bacterial host.

How does mt:CoII differ from other cytochrome oxidase subunits in Drosophila species?

Drosophila species possess multiple cytochrome oxidase subunits that differ in structure, function, and genetic origin:

SubunitGenomic LocationSize (approx.)Primary FunctionSpecial Features
mt:CoIMitochondrialLarger than CoIICatalytic coreOften used in genetic diversity studies
mt:CoIIMitochondrial229 aaElectron transferUsed in evolutionary studies
CoVIaNuclearSmallerRegulatoryMutations linked to neurodegeneration

The mt:CoII subunit is particularly notable for being encoded by the mitochondrial genome, which evolves at a different rate than nuclear genes. This characteristic makes mt:CoII valuable for evolutionary studies and species identification. Unlike nuclear-encoded subunits like CoVIa, which primarily have regulatory functions, mt:CoII forms part of the catalytic core of the enzyme complex. Comparative genomic analyses across Drosophila species have revealed that mt:CoII shows evolutionary conservation in key functional domains while displaying sufficient variability in other regions to serve as a marker for species differentiation .

What role does mt:CoII play in Drosophila phylogenetic studies?

Mt:CoII serves as a valuable molecular marker in Drosophila phylogenetic studies due to several characteristics:

  • Mitochondrial origin - provides maternal lineage information

  • Moderate evolutionary rate - sufficient variation to distinguish closely related species

  • Conserved functional domains - allows for reliable sequence alignment across distant species

  • Availability of comparative data - extensively sequenced across many Drosophila species

Researchers frequently employ mt:CoII sequence analysis to establish evolutionary relationships between Drosophila species and populations . The methodology typically involves PCR amplification of the mt:CoII gene using conserved primers, followed by Sanger sequencing and comparative sequence analysis using software like BioEdit and MEGA XI. These analyses can reveal genetic diversity within populations and evolutionary relationships between species, making mt:CoII particularly useful for studying speciation events and population genetics in Drosophila.

What experimental approaches are most effective for studying the function of recombinant mt:CoII?

Several sophisticated experimental approaches can be employed to study recombinant mt:CoII function:

Enzymatic Activity Assays:

  • Cytochrome c oxidase activity can be measured spectrophotometrically by monitoring the oxidation of reduced cytochrome c at 550 nm

  • Polarographic methods using oxygen electrodes to measure oxygen consumption

  • In-gel activity assays following native PAGE separation

Structural Studies:

  • X-ray crystallography of the purified protein or complex

  • Cryo-electron microscopy to visualize the protein within the COX complex

  • Hydrogen-deuterium exchange mass spectrometry to map protein dynamics

Functional Reconstitution:

  • Incorporation of recombinant mt:CoII into liposomes or nanodiscs

  • Integration into COX-deficient mitochondrial membranes

  • Assembly studies with other COX subunits

Interaction Studies:

  • Crosslinking followed by mass spectrometry to identify interaction partners

  • Surface plasmon resonance to measure binding kinetics with other subunits

  • Yeast two-hybrid or mammalian two-hybrid systems for protein-protein interaction mapping

When conducting these experiments, it's crucial to maintain the native-like environment for mt:CoII, as its function is highly dependent on proper membrane association and complex assembly. Researchers should also consider the impact of the His-tag on function and potentially cleave it for certain applications.

What is the relationship between mt:CoII and the dual function of cytochrome c in respiration and apoptosis?

The relationship between mt:CoII and the dual function of cytochrome c represents a fascinating area of research at the intersection of bioenergetics and cell death pathways:

Respiratory Function:
Mt:CoII forms part of the cytochrome c oxidase complex that accepts electrons from cytochrome c during respiration. This interaction is critical for maintaining the electron flow through the respiratory chain and enabling ATP production.

Apoptotic Function:
Studies in Drosophila have revealed that cytochrome c has two distinct roles: respiration and caspase activation during apoptosis. Drosophila possesses two cytochrome c genes, cyt-c-d and cyt-c-p, with cyt-c-d primarily involved in caspase activation during spermatid differentiation and cyt-c-p required for somatic respiration . Interestingly, both proteins can function interchangeably in respiration and caspase activation when expressed in appropriate tissues.

Mt:CoII's Potential Role in Apoptosis Regulation:
While mt:CoII itself is not directly involved in apoptosis, its interaction with cytochrome c positions it as a potential regulator of cytochrome c availability for apoptotic functions. Alterations in mt:CoII expression or activity could potentially affect the pool of cytochrome c available for release from mitochondria during apoptotic signaling.

Methodologically, this relationship can be studied through:

  • Protein-protein interaction studies between mt:CoII and cytochrome c under different cellular conditions

  • Monitoring cytochrome c release from mitochondria in cells with modified mt:CoII expression

  • Apoptosis assays in cells with altered mt:CoII function

  • Comparative studies of spermatid differentiation in wild-type and mt:CoII mutant Drosophila

How can recombinant mt:CoII be used to study mitochondrial dysfunction in neurodegenerative disorders?

Recombinant mt:CoII offers valuable opportunities for investigating mitochondrial dysfunction in neurodegenerative conditions:

Disease Model Development:

  • Creating transgenic Drosophila expressing mutant forms of mt:CoII to model mitochondrial dysfunction

  • Using recombinant mt:CoII to rescue COX deficiency in patient-derived cell lines

  • Developing in vitro assay systems to screen for compounds that enhance or rescue defective COX activity

Mechanistic Studies:

  • Investigating how mt:CoII mutations affect COX assembly and stability

  • Determining the impact of mt:CoII variants on ROS production

  • Studying the relationship between mt:CoII function and neuronal viability

Research has established connections between cytochrome c oxidase dysfunction and neurodegeneration, with mutations in cytochrome c oxidase subunit VIa causing neurodegeneration and temperature-induced paralysis in Drosophila . Although these findings relate to a different subunit, they highlight the potential of using mt:CoII in similar studies, particularly given the conservation of COX function across subunits.

Methodological approaches include:

  • Site-directed mutagenesis of recombinant mt:CoII to mimic disease-associated variants

  • Complementation studies in COX-deficient cells or organisms

  • Activity assays comparing wild-type and mutant mt:CoII function

  • High-throughput screening for compounds that stabilize mutant mt:CoII or enhance its activity

What are the technical challenges in expressing functional mt:CoII and how can they be overcome?

Expressing functional recombinant mt:CoII presents several technical challenges that researchers must address:

Challenges and Solutions in Recombinant mt:CoII Expression:

ChallengeDescriptionSolution Strategies
Mitochondrial originmt:CoII normally expressed from mtDNA with different genetic codeOptimize codons for expression host; synthesize gene with appropriate codons
Membrane proteinContains hydrophobic domainsUse specialized E. coli strains; include detergents in purification buffers
Complex assemblyNormally functions as part of multi-subunit complexCo-express with other subunits; develop reconstitution methods
Post-translational modificationsMay require specific modificationsConsider eukaryotic expression systems for certain studies
Functional assessmentDifficult to assess activity of isolated subunitDevelop specific activity assays; reconstitute with partner proteins

When expressing mt:CoII in E. coli as described in the commercial product , researchers should consider:

  • Using specialized E. coli strains designed for membrane protein expression

  • Optimizing induction conditions (temperature, IPTG concentration, duration)

  • Including appropriate detergents during cell lysis and purification

  • Confirming proper folding through circular dichroism or other structural analyses

  • Validating functionality through reconstitution experiments

For functional studies, it may be beneficial to co-express mt:CoII with other COX subunits to promote proper assembly. Alternatively, expressing mt:CoII in Drosophila S2 cells or another insect cell system may provide a more native-like environment for proper folding and assembly.

How does mtDNA genome organization affect expression and evolution of mt:CoII in Drosophila species?

The organization of the mitochondrial genome significantly influences both the expression and evolution of mt:CoII in Drosophila species:

Genomic Context and Expression Regulation:
Comparative genomic analyses across Drosophila species have revealed conservation in mitochondrial gene order but variation in intergenic regions . The expression of mt:CoII is influenced by:

  • Proximity to control regions for transcription

  • Conservation of transcription termination signals

  • Post-transcriptional processing of polycistronic mitochondrial transcripts

  • Evolutionary rate variation across intergenic regions

Evolutionary Considerations:
Mt:CoII exhibits patterns of sequence conservation that reflect both functional constraints and evolutionary pressures:

  • Catalytic domains show high conservation across species

  • Peripheral regions exhibit greater variability

  • Intergenic regions surrounding mt:CoII harbor the majority of mitochondrial indel divergence

To study these aspects methodologically, researchers employ:

  • Comparative sequence analysis across multiple Drosophila species

  • Transcriptomic approaches to map transcription start sites and processing events

  • Evolutionary rate analysis to identify regions under selection

  • Functional studies to correlate sequence conservation with enzymatic activity

This research not only provides insights into mt:CoII function but also contributes to our understanding of mitochondrial genome evolution and expression regulation in insects.

What is the significance of mt:CoII in understanding the genetic diversity of Drosophila populations?

Mt:CoII serves as a powerful marker for studying genetic diversity and population structure in Drosophila species:

Applications in Population Genetics:

  • Identification of cryptic species within Drosophila complexes

  • Tracking population movements and colonization events

  • Measuring genetic diversity within and between populations

  • Inferring historical population dynamics and demographic changes

Methodological Approach:
Studies of genetic diversity typically follow this workflow:

  • Sample collection from different geographical regions

  • DNA extraction from thoracic tissue

  • PCR amplification of the mt:CoII gene

  • Sanger sequencing of PCR products

  • Sequence characterization and alignment using bioinformatics tools (e.g., BioEdit, MEGA XI)

  • Population genetic analyses (diversity indices, neutrality tests, phylogenetic reconstruction)

This approach has been successfully applied to study Drosophila populations in various regions, including North Sulawesi . The mitochondrial origin of mt:CoII provides additional value for these studies as it allows tracking of maternal lineages and often shows clearer phylogeographic patterns than nuclear markers due to its lack of recombination and smaller effective population size.

How can structural characterization of mt:CoII contribute to understanding its function and evolution?

Structural characterization of mt:CoII provides critical insights into both its functional mechanisms and evolutionary history:

Structural Analysis Approaches:

  • X-ray crystallography of purified recombinant mt:CoII

  • Cryo-electron microscopy of the entire COX complex

  • Homology modeling based on structures from related species

  • Molecular dynamics simulations to study protein dynamics

  • Structure-guided mutagenesis to test functional hypotheses

Functional Insights from Structure:
Structural analysis can reveal:

  • Metal binding sites crucial for electron transfer

  • Interaction surfaces with other COX subunits

  • Membrane-embedded regions and their orientation

  • Substrate binding channels and catalytic residues

  • Conformational changes during the catalytic cycle

Evolutionary Insights:
Structural comparisons across species can:

  • Identify functionally constrained regions under purifying selection

  • Reveal adaptive changes in specific lineages

  • Provide molecular explanations for species-specific functional differences

  • Clarify the structural basis for temperature adaptation in different Drosophila species

By combining structural data with functional assays and evolutionary analyses, researchers can develop comprehensive models of how mt:CoII structure relates to its function in cellular respiration and how structural adaptations have contributed to the evolutionary success of different Drosophila lineages across diverse environments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.