Recombinant Drosophila mauritiana ATP synthase subunit a (mt:ATPase6)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

Biochemical Pathways Involving mt:ATPase6

PathwayKey Interactions
Oxidative PhosphorylationCoordinates with Complexes I-IV to generate proton gradient
ATP SynthesisDirectly participates in ADP-to-ATP conversion via F₀-F₁ coupling

Adapted from pathway data

Expression and Activity in Drosophila

  • Gene Regulation: ATPsynC (subunit c) in Drosophila shows high expression during larval stages and pupal-adult transition, suggesting tight regulatory coordination with mt:ATPase6 .

  • ATP Synthase Activity: Defective subunit assembly (e.g., ATPsynC mutants) reduces ATP production, highlighting the interdependence of subunits .

Gene Information and Evolutionary Context

PropertyDetails
Gene Symbolmt:ATPase6
SpeciesDrosophila mauritiana
ConservationHigh sequence similarity across Drosophila species
Chromosomal LocationNot explicitly documented for D. mauritiana; in D. melanogaster, ATP synthase genes cluster near telomeres

Future Directions and Challenges

  • Therapeutic Targets: Studying mt:ATPase6 could inform treatments for mitochondrial diseases, though homology to human ATP6 (subunit 6) requires caution .

  • Structural Insights: Cryo-EM studies of recombinant mt:ATPase6 could resolve proton channel mechanics.

Data Tables and References

Table 1: mt:ATPase6-Related Pathways and Proteins

PathwayAssociated Proteins
ATP SynthesisATP5A, ATP5B, ATP5C, ATP5D, ATP5E, ATP5F1, ATP5G1, ATP5G2, ATP5G3
Proton TranslocationATP6 (subunit a in other species), ATP8, ATP9

Source: Creative BioMart pathway data

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag during production.
Synonyms
mt:ATPase6; ATP6; ATPase6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Drosophila mauritiana (Fruit fly)
Target Names
mt:ATPase6
Target Protein Sequence
MMTNLFSVFDPSAIFNLSLNWLSTFLGLLMIPSIYWLMPSRYNIVWNSILLTLHKEFKTL LGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWIN HTQHMFAHLVPQGTPAVLMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGP SMSYLLVTFLLTAQIALLVLESAVAMIQSYVFAVLSTLYSSEVN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) catalyzes the synthesis of ATP from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), which contains the extramembraneous catalytic core, and F(0), which houses the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation via a rotary mechanism of the central stalk subunits. This subunit is a key component of the proton channel and may directly participate in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (mt:ATPase6) in Drosophila?

ATP synthase is a complex enzyme composed of multiple subunits organized into two major functional domains: the F1 domain, which projects into the mitochondrial matrix, and the F0 domain, which is embedded in the mitochondrial inner membrane. The subunit a (encoded by mt:ATPase6) is a critical component of the F0 domain. In Drosophila, as in other organisms, this subunit plays an essential role in proton translocation across the inner mitochondrial membrane, which drives ATP synthesis .

To study this structure, researchers typically use techniques like cryo-electron microscopy for structural visualization and site-directed mutagenesis to determine functional domains. Blue native PAGE is commonly employed to analyze intact ATP synthase complexes from isolated mitochondria.

How are mt:ATPase6 mutations identified and characterized in Drosophila models?

Identifying and characterizing mt:ATPase6 mutations in Drosophila involves a systematic approach:

  • PCR amplification of the mt:ATPase6 gene from total DNA extracts

  • Sequencing of amplicons to identify polymorphisms or mutations

  • Creation of heteroplasmic flies carrying both wild-type and mutant mtDNA to assess mutation effects

  • Phenotypic characterization of mutant flies, including viability, fertility, and behavioral assays

  • Biochemical assays to measure ATP production and oxygen consumption

Mutations in ATP synthase subunits, including mt:ATPase6, can result in severe phenotypes ranging from larval lethality to complex pleiotropic effects including developmental delay, early adult lethality, hypoactivity, sterility, hypofertility, aberrant courtship behavior, locomotor defects, and aberrant gonadogenesis .

What techniques are used to isolate and purify recombinant mt:ATPase6 for functional studies?

While mt:ATPase6 is encoded by mitochondrial DNA rather than nuclear DNA, researchers can create recombinant versions through several approaches:

Methodology:

  • Design a nuclear-encoded version of mt:ATPase6 with appropriate mitochondrial targeting sequence

  • Clone the construct into expression vectors with tissue-specific promoters

  • Transform Drosophila cells or create transgenic flies

  • Isolate mitochondria through differential centrifugation

  • Extract membrane proteins using detergents like n-dodecyl-β-D-maltoside

  • Purify using affinity chromatography (if tagged) or ion exchange chromatography

For functional studies, researchers often use heteroplasmic flies containing both endogenous mt:ATPase6 and recombinant variants to study their interaction and function in vivo .

How can homologous recombination be induced to create specific mt:ATPase6 variants in Drosophila?

Creating specific mt:ATPase6 variants through homologous recombination requires sophisticated techniques leveraging the natural mtDNA repair mechanisms:

Step-by-Step Methodology:

  • Generate heteroplasmic flies carrying two closely related mitochondrial genomes with sufficient sequence homology to allow recombination

  • Express mitochondrially-targeted restriction endonucleases (mito-REs) that create double-strand breaks (DSBs) at specific positions in the mtDNA

  • Leverage REC (MCM helicase) activity, which facilitates mtDNA recombination during DSB repair

  • Screen progeny for recombinant mtDNA using PCR-RFLP or sequencing

  • Establish homoplasmic lines through selective breeding

This approach yields recombinant mtDNA through accurate homology-dependent repair. Research shows that the frequency of isolating progeny with recombinant mtDNA decreases by ~40% in flies with reduced mitochondrial REC (REC^ΔMTS-Halo) and by >80% in flies completely lacking REC (REC^KO-Halo) .

What are the effects of specific mt:ATPase6 mutations on mitochondrial morphology and bioenergetics?

Mt:ATPase6 mutations can profoundly impact mitochondrial structure and function:

Research Methodology:

  • Create specific mt:ATPase6 mutations through site-directed mutagenesis or heteroplasmy-based approaches

  • Analyze mitochondrial morphology using:

    • Electron microscopy for ultrastructural analysis

    • Confocal microscopy with mitochondrial markers (e.g., MitoTracker)

  • Assess bioenergetic impacts through:

    • Measurement of cellular ATP levels

    • Oxygen consumption rate analysis

    • Membrane potential assays using fluorescent probes

    • Blue native PAGE to assess ATP synthase complex assembly

Research shows that ATPsynC (nuclear-encoded subunit c) mutations impair ATP synthesis and mitochondrial morphology in Drosophila, and by extension, mutations in mt:ATPase6 are expected to have similar effects .

How do different Drosophila species vary in mt:ATPase6 sequence and function?

Interspecies variation in mt:ATPase6 provides valuable insights into evolutionary conservation and functional constraints:

Comparative Analysis Approach:

  • Sequence mt:ATPase6 from multiple Drosophila species (melanogaster, mauritiana, simulans, etc.)

  • Perform multiple sequence alignment to identify conserved and variable regions

  • Conduct tests for selection pressure (dN/dS ratio) to identify functionally constrained regions

  • Create chimeric constructs combining regions from different species

  • Express these constructs in cell lines or transgenic flies to assess functional differences

Studies have leveraged the homology between mtDNA of closely related Drosophila species to create heteroplasmic flies for recombination studies, indicating sufficient sequence conservation while maintaining polymorphisms for identification .

What methods are most effective for studying mt:ATPase6 heteroplasmy dynamics?

Studying heteroplasmy dynamics requires specialized techniques:

Methodological Framework:

  • Create heteroplasmic flies carrying different mt:ATPase6 variants

  • Track heteroplasmy levels across generations using:

    • Quantitative PCR with allele-specific primers

    • Next-generation sequencing with deep coverage

    • Restriction fragment length polymorphism (RFLP) analysis

  • Apply selective pressures (e.g., temperature shifts) to observe segregation biases

  • Analyze tissue-specific heteroplasmy using laser-capture microdissection

  • Monitor fitness effects under different environmental conditions

Research demonstrates that heteroplasmic flies carrying mt:ATP6 and a temperature-sensitive lethal mutant genome show specific segregation patterns, with spontaneous recombination generating functional hybrid mitochondrial genomes that can rescue otherwise lethal phenotypes .

How does REC helicase influence mtDNA recombination involving mt:ATPase6?

REC helicase plays a crucial role in mtDNA recombination:

Experimental Approach:

  • Generate flies with different REC expression levels:

    • Wild-type REC-Halo (control)

    • REC^ΔMTS-Halo (reduced mitochondrial targeting)

    • REC^KO-Halo (complete knockout)

  • Create heteroplasmic flies carrying distinct mt:ATPase6 variants

  • Induce DSBs using mitochondrially-targeted restriction enzymes

  • Quantify recombination frequency through sequencing

  • Map recombination breakpoints and analyze repair accuracy

Research shows that REC is recruited to mitochondria following mtDNA damage, particularly DSBs, and facilitates repair through homologous recombination. The frequency of spontaneous recombination is significantly reduced in flies with decreased mitochondrial REC, with only 2 recombinant lineages recovered from REC^ΔMTS-Halo flies compared to 13 from wild-type controls .

What are the best protocols for isolating intact mitochondria from Drosophila for mt:ATPase6 studies?

Detailed Protocol:

  • Homogenize tissue in isolation buffer (250mM sucrose, 10mM Tris-HCl, 1mM EDTA, pH 7.4)

  • Perform differential centrifugation:

    • 1,000g, 10 minutes to remove nuclei and debris

    • 10,000g, 15 minutes to isolate crude mitochondria

  • Purify through Percoll gradient centrifugation

  • Perform proteinase K protection assay to verify mitochondrial integrity:

    • Treatment with proteinase K leaves matrix proteins intact

    • Hypo-osmotic treatment compromises outer membrane

    • Detergent treatment exposes all proteins to degradation

This approach enables assessment of protein localization within mitochondrial compartments. For example, REC protein is resistant to proteolytic degradation after hypo-osmotic treatment, similar to matrix proteins like mtDNA polymerase PolG1 and ATP5A .

What techniques enable precise measurement of ATP synthase activity in Drosophila with mt:ATPase6 mutations?

Quantitative Analysis Methods:

  • ATP production assay:

    • Isolate mitochondria from flies with specific mt:ATPase6 variants

    • Provide substrate (e.g., pyruvate/malate or succinate)

    • Measure ATP production using luciferase-based assays

  • Oxygen consumption analysis:

    • Use high-resolution respirometry (Oroboros or Seahorse)

    • Assess various respiratory states with substrate additions

    • Calculate respiratory control ratios

  • ATP synthase-specific activity:

    • Spectrophotometric assay coupling ATP hydrolysis to NADH oxidation

    • Oligomycin sensitivity to confirm ATP synthase specificity

    • Blue native PAGE with in-gel activity staining

These methods enable quantitative assessment of ATP synthase function, which is critical for understanding the impact of specific mt:ATPase6 mutations on cellular bioenergetics.

How can researchers effectively design and implement experiments to study mt:ATPase6 recombination in vivo?

Experimental Design Framework:

  • Selection of appropriate genetic backgrounds:

    • Choose Drosophila strains with well-characterized mtDNA

    • Create heteroplasmic lines with distinct mt:ATPase6 variants

  • Induction of recombination:

    • Express mitochondrially-targeted restriction enzymes under tissue-specific promoters

    • Use temperature shifts for temperature-sensitive variants

    • Apply genetic strategies to modulate repair proteins (e.g., REC)

  • Analysis of recombination events:

    • PCR amplification of target regions

    • Next-generation sequencing to identify breakpoints

    • Functional assessment of resulting ATP synthase activity

  • Quantification methods:

    • Calculate recombination frequency per generation

    • Map distribution of breakpoints to identify hotspots

    • Correlate recombination with phenotypic outcomes

Researchers have successfully implemented such approaches by creating heteroplasmic flies carrying mitochondrial genomes from closely related Drosophila species and inducing DSBs at different positions using mito-REs .

What statistical approaches are most appropriate for analyzing heteroplasmy data in mt:ATPase6 research?

Statistical Framework:

  • Quantification of heteroplasmy levels:

    • Bayesian methods for accurately estimating allele frequencies

    • Poisson distribution models for sampling error

    • Bootstrap resampling for confidence intervals

  • Analysis across generations:

    • Linear mixed models to account for maternal inheritance

    • Time series analysis for tracking heteroplasmy changes

    • Variance component analysis to separate stochastic and selective effects

  • Tissue-specific analysis:

    • ANOVA for comparing heteroplasmy across tissues

    • Regression models to identify factors influencing segregation

    • Power analysis to determine adequate sample sizes

Analysis TypeRecommended TestSample Size RequirementsSoftware
Heteroplasmy QuantificationBayesian Estimation30+ flies per genotypeBEAST, R packages
Generational ChangesLinear Mixed Models5+ generationsR (lme4)
Tissue ComparisonANOVA/MANOVA10+ samples per tissueSPSS, R
Survival AnalysisKaplan-Meier50+ flies per conditionGraphPad Prism

How should researchers interpret contradictory findings in mt:ATPase6 function across different Drosophila models?

When faced with contradictory findings, researchers should:

  • Evaluate experimental context:

    • Different genetic backgrounds can influence phenotypic outcomes

    • Environmental conditions (temperature, diet) affect mitochondrial function

    • Age-dependent effects may explain temporal discrepancies

  • Consider methodological differences:

    • Heteroplasmy levels and distribution vary between models

    • Assay sensitivity differs between laboratories

    • Tissue-specific effects may not be generalizable

  • Systematic resolution approach:

    • Direct comparison experiments with standardized conditions

    • Meta-analysis of published data with weighting for methodological rigor

    • Collaboration between labs to replicate key findings

  • Integration framework:

    • Develop unified models that incorporate context-dependent effects

    • Identify core phenotypes consistent across models

    • Acknowledge limitations and boundary conditions for each finding

Research shows that even subtle differences in experimental approach can yield apparently contradictory results, as seen in studies of REC-mediated mtDNA recombination where tissue-specific effects were observed .

What are the implications of mt:ATPase6 research in Drosophila for understanding human mitochondrial diseases?

Translational Research Framework:

  • Cross-species conservation analysis:

    • Sequence homology between Drosophila and human mt:ATPase6

    • Functional conservation of ATP synthase assembly and activity

    • Comparison of mutation effects across species

  • Disease modeling potential:

    • Drosophila mt:ATPase6 mutations can model human mitochondrial diseases

    • Parallel pathological mechanisms include energy deficiency, ROS production

    • Three broad categories of ATP synthase dysfunction have been identified:
      a) Pre-adult lethality
      b) Multi-trait pathology with early adult lethality
      c) Multi-trait adult pathology

  • Therapeutic screening opportunities:

    • Drosophila models enable high-throughput compound screening

    • Genetic modifier screens can identify potential intervention targets

    • Manipulation of mtDNA heteroplasmy offers potential therapeutic avenues

The high degree of conservation in mitochondrial function across species suggests that findings from Drosophila research can provide valuable insights for human mitochondrial disease understanding and treatment development.

How might CRISPR/Cas9 technologies be adapted for direct editing of mt:ATPase6 in Drosophila?

Innovative Methodological Approach:

  • Developing mitochondrially-targeted CRISPR systems:

    • Engineer Cas9 with mitochondrial targeting sequences

    • Optimize guide RNA delivery to mitochondria

    • Develop alternative nucleases with mitochondrial compatibility

  • Base editing approaches:

    • Adapt cytidine or adenine deaminases for mitochondrial targeting

    • Design specific targeting strategies for mt:ATPase6 sequences

    • Validate editing efficiency using deep sequencing

  • Leveraging natural mtDNA recombination:

    • Combine CRISPR-induced breaks with REC-mediated repair

    • Provide donor templates for homology-directed repair

    • Select for edited mtDNA through phenotypic rescue

These approaches could overcome current limitations in direct mtDNA editing and enable precise modification of mt:ATPase6 sequences for functional studies and disease modeling.

What novel techniques could improve the study of mt:ATPase6 interaction with nuclear-encoded ATP synthase subunits?

Advanced Research Methods:

  • Proximity labeling approaches:

    • Express mt:ATPase6 fused to BioID or APEX2

    • Identify interacting proteins through mass spectrometry

    • Map interaction domains through mutational analysis

  • Single-molecule visualization:

    • Super-resolution microscopy of tagged subunits

    • Live cell imaging of ATP synthase assembly

    • FRET-based assays for subunit interactions

  • Organelle-specific interactome analysis:

    • Mitochondria-specific protein correlation profiling

    • Cross-linking mass spectrometry for direct contacts

    • Genetic interaction screens to identify functional relationships

These techniques would provide unprecedented insights into how mt:ATPase6 interacts with nuclear-encoded subunits like subunit c (encoded by ATPsynC) and other components of the ATP synthase complex .

How might heteroplasmy of mt:ATPase6 variants contribute to aging and degenerative phenotypes in Drosophila?

Longitudinal Research Design:

  • Creating defined heteroplasmic models:

    • Generate flies with precise ratios of wild-type and mutant mt:ATPase6

    • Develop inducible systems to alter heteroplasmy during specific life stages

    • Create tissue-specific heteroplasmy models

  • Aging-specific analyses:

    • Track heteroplasmy changes throughout lifespan

    • Correlate with markers of mitochondrial function

    • Assess tissue-specific degenerative phenotypes

  • Molecular mechanisms:

    • Evaluate ROS production and oxidative damage

    • Measure mitochondrial quality control responses

    • Assess activation of stress-response pathways

  • Intervention testing:

    • Dietary manipulations (caloric restriction, ketogenic diet)

    • Exercise/activity modulation

    • Pharmacological approaches targeting mitochondrial function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.