Recombinant Drosophila melanogaster 5-hydroxytryptamine receptor 2B (5-HT1B)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
5-HT1B; 5HT-R2B; CG15113; 5-hydroxytryptamine receptor 2B; 5-HT receptor 2B; 5-hydroxytryptamine receptor 1B; 5-HT receptor 1B; Serotonin receptor 1B; Serotonin receptor 2B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-617
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
5-HT1B
Target Protein Sequence
MLKTVTTAMAAGDDDVPASILEIELPAILLNESLFIELNGNLTQLVDTTSNLSQIVWNRS
INGNGNSNTFDLVDDEQERAAVEFWLLVKMIAMAVVLGLMILVTIIGNVFVIAAIILERN
LQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWILGPELCDIWTSCDVLCCTASILH
LVAIAADRYWTVTNIDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWKDPDYMKRIEEQ
HCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQKSFNVTLTETDCDS
AVRELKKERSKRRAERKRLEAGERTPVDGDGTGGQLQRRTRKRMRICFGRNTNTANVVAG
SEGAVARSMAAIAVDFASLAITREETEFSTSNYDNKSHAGTELTTVSSDADDYRTSNANE
IITLSQQVAHATQHHLIASHLNAITPLAQSIAMGGVGCLTTTTPSEKALSGAGTVAGAVA
GGSGSGSGEEGAGTEGKNAGVGLGGVLASIANPHQKLAKRRQLLEAKRERKAAQTLAIIT
GAFVICWLPFFVMALTMSLCKECEIHTAVASLFLWLGYFNSTLNPVIYTIFNPEFRRAFK
RILFGRKAAARARSAKI
Uniprot No.
Target Background
Function
This receptor is one of several involved in the binding of 5-hydroxytryptamine (serotonin), a biogenic hormone acting as a neurotransmitter, hormone, and mitogen. The receptor's activity is mediated by G proteins, which inhibit adenylate cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
