Recombinant Drosophila melanogaster Adenosine monophosphate-protein transferase FICD homolog (CG9523)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Fic; CG9523; Protein adenylyltransferase Fic; dFic; De-AMPylase Fic
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-492
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Fic
Target Protein Sequence
MGTEAEQPSPPAQQQDQENPPLCKAQNPKPARLYRFVLIFVAGSLAAWTFHALSSTNLVW KLRQLHHLPTAHYLQTRDEFALYSVEELNAFKEFYDKSVSDSVGASYTEAEQTNIKEALG ALRMAQDLYLAGKDDKAARLFEHALALAPRHPEVLLRYGEFLEHNQRNIVLADQYYFQAL TISPSNSEALANRQRTADVVQSLDERRLESLDSKRDALSAIHESNGALRRAKKEAYFQHI YHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKIDITIK DILELHRRVLGHVDPIEGGEFRRNQVYVGGHIPPGPGDLALLMQRFERWLNSEHSSTLHP VNYAALAHYKLVHIHPFVDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFLKLANE GDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQTESEAGERLAQMQSPNVAQRSSI LEFYESGSGDLP
Uniprot No.

Target Background

Function
This protein exhibits dual enzymatic activity: AMPylation (addition of adenosine 5'-monophosphate to target proteins) and de-AMPylation (removal of AMP). Glu-247 residue dictates which activity predominates. It plays a crucial regulatory role in the unfolded protein response (UPR) by modulating the AMPylation/de-AMPylation of Hsc70-3/BiP. Under unstressed conditions, it AMPylates Hsc70-3/BiP at Thr-518, thus inactivating it. During endoplasmic reticulum stress, it de-AMPylates Hsc70-3/BiP at Thr-518, restoring HSPA5/BiP activity.
Gene References Into Functions
  1. Studies, including those using transgenic animals, suggest that Fic dimerization partially regulates Fic's dual enzymatic activity. Loss of dimerization enhances AMPylation and reduces de-AMPylation of BiP/Grp78. (Fic = Fic domain-containing protein; BiP/Grp78 = molecular chaperone BiP) PMID: 29089387
  2. Inactive BiP conformation is the preferred substrate for dFic. PMID: 25395623
  3. Our findings support the involvement of Fic's enzymatic activity in regulating the distribution of the visual neurotransmitter histamine. PMID: 22544313
Database Links

KEGG: dme:Dmel_CG9523

STRING: 7227.FBpp0078887

UniGene: Dm.11352

Protein Families
Fic family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the functional significance of FICD homolog (CG9523) in Drosophila melanogaster models?

FICD homolog (CG9523) in Drosophila melanogaster functions as an adenosine monophosphate-protein transferase that catalyzes AMPylation and deAMPylation of the endoplasmic reticulum (ER) chaperone BiP. This post-translational modification plays a crucial role in regulating the unfolded protein response (UPR) pathway.

Research has demonstrated that Drosophila Fic (CG9523) is oriented within the ER lumen, where it can catalyze protein modifications that directly impact ER homeostasis . The protein is classified as a Type II transmembrane protein with its C-terminal Fic domain positioned to interact with ER-resident proteins . Functional studies reveal that Fic is essential for proper neurological function, as Fic null mutants exhibit locomotor impairment and accumulation of reactive oxygen species (ROS) in the ventral nerve cord .

How should researchers approach experimental design when investigating FICD homolog expression patterns in Drosophila tissues?

When investigating FICD homolog expression patterns, researchers should implement a multi-faceted approach combining both in situ and ex vivo techniques:

  • Tissue-specific expression analysis: Utilize GAL4-UAS system with tissue-specific drivers to express fluorescent reporters under the control of the CG9523 promoter.

  • Temporal expression profiling: Consider developmental timepoints using precisely staged embryos, larvae, and adult flies.

  • Subcellular localization studies: Employ immunofluorescence with antibodies against the FICD homolog or epitope-tagged versions of the protein to confirm ER localization.

  • Controls: Include both negative controls (Fic null mutants) and positive controls (known ER-resident proteins) to validate expression patterns.

For quantitative expression analysis, statistical approaches such as ANOVA or non-parametric alternatives should be employed based on data distribution . When analyzing multiple tissues or timepoints, consider using randomized block design to account for batch effects .

What are the optimal storage and handling conditions for recombinant Drosophila melanogaster FICD homolog?

Based on established protocols for recombinant FICD homolog (CG9523), the following storage and handling conditions are recommended:

Storage conditions:

  • Store at -20°C for routine usage

  • For extended storage, maintain at -80°C

  • Avoid repeated freeze-thaw cycles; instead, prepare working aliquots stored at 4°C for up to one week

Buffer composition:

  • Tris-based buffer with 50% glycerol, specifically optimized for this protein

Handling recommendations:

  • Thaw protein samples on ice

  • Centrifuge briefly before opening tubes to collect solution

  • Use non-stick tubes for dilutions

  • Consider adding reducing agents (e.g., DTT) for experiments requiring maintenance of thiol groups

These recommendations are based on established protocols for recombinant Drosophila proteins and specific information from commercial sources .

What experimental approaches can resolve contradictory data on FICD homolog function in different genetic backgrounds?

When faced with contradictory results regarding FICD homolog function across different genetic backgrounds, researchers should implement a systematic approach:

  • Genetic background standardization:

    • Create isogenic lines through backcrossing (minimum 6-10 generations) to eliminate background effects

    • Use precise gene editing techniques (CRISPR/Cas9) to introduce identical mutations in different backgrounds

  • Comprehensive phenotypic analysis:

    • Quantify multiple phenotypes (locomotor ability, ROS levels, BiP levels, ER stress markers)

    • Implement standardized assays with clear quantitative outputs

  • Statistical reconciliation approaches:

    • Apply meta-analysis techniques to integrate results across studies

    • Utilize mixed-effects models to account for genetic background as a random effect

  • Environmental variable control:

    • Standardize rearing conditions (temperature, humidity, diet)

    • Consider interaction terms in statistical models to account for GxE effects

In a recent study examining Drosophila Fic null mutants, researchers observed that phenotypic variations were partially attributable to genetic background effects. By implementing controlled crosses with precisely defined genetic backgrounds, they were able to isolate Fic-specific phenotypes from background effects .

Experimental ApproachApplication to FICD ResearchStatistical Method
Isogenic background creationEliminate genetic variationN/A
Quantitative phenotypingMeasure locomotor impairment, ROS levelsANOVA, t-tests
Molecular phenotypingBiP levels, AMPylation statusWestern blot quantification
Multi-generational analysisIdentify parent-of-origin effectsChi-square tests
Environmental manipulationTest temperature sensitivityTwo-way ANOVA

How can researchers optimize fluorescence polarization (FP) assays for monitoring FICD-mediated AMPylation activities?

Fluorescence polarization (FP) assays provide a powerful tool for monitoring FICD-mediated AMPylation in real-time. To optimize these assays:

  • Probe selection and optimization:

    • Use Fl-ATP (N6-(6-amino)hexyl-ATP-5-carboxyl-fluorescein) as the fluorescent substrate

    • Optimize probe concentration (typically 100-500 nM) to achieve sufficient signal-to-noise ratio

    • Validate probe specificity with catalytically inactive FICD mutants (H363A)

  • Reaction conditions:

    • Buffer composition: Tris-HCl (pH 7.5), MgCl₂ (5-10 mM), and KCl (50-100 mM)

    • Include 0.1% Triton X-100 to prevent protein aggregation

    • Temperature control: Maintain consistent temperature (25-30°C)

  • Controls and validation:

    • Include E234G FICD (constitutively active) as positive control

    • Use wild-type FICD with DMSO as negative control

    • Validate results with orthogonal methods (radioactive in-gel AMPylation assays)

  • Data analysis:

    • Apply four-parameter logistic regression for concentration-response curves

    • Calculate Z' and signal-to-background ratios to assess assay quality

    • Normalize data to internal controls (positive: E234G FICD; negative: WT FICD)

Research has demonstrated that FP assays can effectively distinguish between wild-type FICD (low autoAMPylation) and E234G FICD (high autoAMPylation), with Z' values consistently above 0.5, indicating excellent assay quality .

What are the most effective strategies for designing experiments to investigate the tissue-specific roles of FICD in neurological disorders using Drosophila models?

When investigating FICD's role in neurological disorders using Drosophila models, researchers should implement a comprehensive experimental approach:

  • Tissue-specific manipulation:

    • Utilize the GAL4-UAS system with neuron-specific drivers (e.g., elav-GAL4 for pan-neuronal expression)

    • Implement temporally controlled expression using GAL80ᵗˢ for stage-specific studies

    • Consider cell-type specific drivers (motor neurons, glia) to dissect cell-autonomous effects

  • Functional assays for neurological phenotypes:

    • Locomotor assays: climbing tests, activity monitors

    • Lifespan analysis: survival curves with appropriate controls

    • Electrophysiological recordings: neuromuscular junction (NMJ) recordings

  • Molecular analysis:

    • Measure BiP levels in specific neural tissues using immunohistochemistry

    • Quantify ROS levels using fluorescent indicators (e.g., DHE staining)

    • Assess ER stress using XBP1 splicing assays

  • Therapeutic interventions:

    • Test chemical chaperones (e.g., PBA) to rescue ROS phenotypes

    • Implement genetic rescue experiments using human FICD expression

    • Perform drug screens to identify compounds that modify FICD activity

The Drosophila model has proven particularly valuable for studying FICD-related neurological disorders, as Fic null mutants recapitulate key features of Hereditary Spastic Paraplegia (HSP), including locomotor impairment and increased ROS in the ventral nerve cord .

How should researchers approach statistical analysis for complex experimental designs involving FICD in Drosophila models?

For complex experimental designs involving FICD in Drosophila models, researchers should implement a rigorous statistical framework:

  • Experimental design considerations:

    • Power analysis: Determine appropriate sample sizes based on expected effect sizes and variability

    • Randomization: Randomly assign flies to treatment groups to minimize bias

    • Blinding: Ensure researchers are blinded to treatment groups during data collection and analysis

    • Controls: Include both positive and negative controls in each experimental batch

  • Statistical approach selection:

    • For normally distributed data: parametric tests (t-tests, ANOVA)

    • For non-normal data: non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis)

    • For complex designs: mixed-effects models to account for random effects

  • Multiple comparisons:

    • Apply appropriate corrections (Bonferroni, Benjamini-Hochberg) for multiple hypothesis testing

    • Report both raw and adjusted p-values

  • Effect size reporting:

    • Include measures of effect size (Cohen's d, η²) alongside p-values

    • Report confidence intervals to indicate precision of estimates

As highlighted in the literature, "the lower the unsystematic variability (random error), the more sensitive is our statistical test to treatment effects" . For FICD studies, this principle is particularly important given the complex phenotypes and potential genetic background effects that can introduce variability.

What methods are most effective for visualizing FICD-mediated post-translational modifications in Drosophila tissues?

To effectively visualize FICD-mediated post-translational modifications in Drosophila tissues:

  • Immunohistochemical approaches:

    • Develop or obtain modification-specific antibodies (anti-AMPylated-BiP)

    • Use fluorescent secondary antibodies for confocal microscopy

    • Implement super-resolution microscopy (STED, STORM) for subcellular localization

  • Biochemical detection:

    • In-gel AMPylation assays using fluorescent ATP analogs

    • Radioactive assays using α-32P-ATP for enhanced sensitivity

    • Mass spectrometry to identify AMPylation sites and quantify modification levels

  • Genetic reporters:

    • Develop BiP-based FRET sensors to monitor AMPylation in real-time

    • Create split-fluorescent protein constructs that report on FICD-BiP interactions

  • Visualization controls:

    • Use Fic null mutants as negative controls

    • Include E234G FICD (constitutively active) tissues as positive controls

    • Generate AMPylation-resistant BiP mutants for specificity validation

Research has demonstrated that FICD-mediated modifications can be effectively visualized using both fluorescence-based and radioactive approaches, with each method offering distinct advantages depending on the experimental context .

How does homolog pairing in Drosophila affect experimental design when studying FICD gene function?

Homolog pairing in Drosophila—the physical association of maternal and paternal chromosomes in somatic cells—presents unique considerations for FICD gene function studies:

  • Impact on gene expression:

    • Transvection effects: Expression of one allele can influence the other through homolog pairing

    • Pairing-sensitive silencing: Some mutations show different phenotypes depending on homozygosity vs. heterozygosity

  • Experimental design adjustments:

    • Generate homozygous stocks to eliminate transvection variability

    • Use balancer chromosomes to track inheritance and prevent recombination

    • Design experiments that account for potential transvection effects

  • Advanced genetic approaches:

    • Implement haplotype-resolved techniques to distinguish maternal and paternal contributions

    • Consider using RNAi to disrupt pairing-promoting factors

    • Apply Hi-C techniques to analyze pairing architecture

Research has shown that homologs pair with varying precision genome-wide, establishing trans-homolog domains and compartments . The structure of pairing exhibits significant variation across the genome, with at least two forms identified: tight pairing (spanning contiguous small domains) and loose pairing (consisting of single larger domains) . Notably, active genomic regions (including expressed genes) correlate with tight pairing, suggesting functional implications for gene expression .

What considerations are important when creating deletion mutants of FICD in Drosophila for functional studies?

When generating deletion mutants of FICD in Drosophila for functional studies, researchers should consider:

  • Deletion design strategies:

    • P-element-mediated "male recombination" between two P elements in trans can create precise deletions

    • CRISPR/Cas9-mediated deletions offer more precision but may require extensive screening

    • Consider generating both null alleles and hypomorphic alleles for dose-response studies

  • Screening and validation approaches:

    • PCR-based genotyping to confirm deletion boundaries

    • Southern blot analysis to validate larger genomic rearrangements

    • RT-PCR and Western blot to confirm absence of transcript and protein

  • Phenotypic characterization:

    • Test viability (homozygous and hemizygous over deficiency)

    • Evaluate both expected phenotypes (locomotor defects) and potential novel phenotypes

    • Perform rescue experiments with wild-type constructs to confirm specificity

  • Genetic background considerations:

    • Backcross deletion lines to establish isogenic backgrounds

    • Maintain stocks over balancer chromosomes to prevent inadvertent selection

    • Generate precise revertants as controls

Research has demonstrated that when creating deletion mutants, approximately 25% may be viable when homozygous or hemizygous, while the remainder cause lethality . This highlights the importance of careful screening and characterization of multiple independent lines to identify the most useful alleles for functional studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.