Recombinant Drosophila melanogaster ADIPOR-like receptor CG5315 (CG5315)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
AdipoR; CG5315; Adiponectin receptor protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
AdipoR
Target Protein Sequence
MDSATNLLEQQGSAADVSGGSHPAEVEVTTQARATFGMDAEGHATGEAVTTTTATLRREG SDEDIFEQVQMILRKRRGWGPEDSLSPNDLDILEYDDELVEEDDAGCPLPSTPEDTQLIE AEMTEVLKAGVLSDEIDLGALAHNAAEQAEEFVRKVWEASWKVCHYKNLPKWLQDNDFLH RGHRPPLPSFRACFKSIFRVHTETGNIWTHLLGCIAFIGVALYFISRPSVEIQTQEKIVF GAFFIGAIVCLGFSFAFHTLSCHSVEMGRLFSKLDYCGIALLIMGSFVPWLYYGFYCHYQ PKVIYLSVVSILGILSIVVSLWDKFSEPALRPLRAGVFMSFGLSGVIPAIHYSIMEGWFS QMSRASLGWLILMGLLYILGALLYALRVPERWFPGKFDIWGQSHQIFHILVIAAAFVHYH GISEMAMYRVMYSECTVPIEPITF
Uniprot No.

Target Background

Function
Adiponectin receptor. In insulin-producing cells, it regulates insulin secretion and controls glucose and lipid metabolism.
Gene References Into Functions
  1. AdipoR is intrinsically required for germline stem cell maintenance in the Drosophila ovary. PMID: 25576925
Database Links

KEGG: dme:Dmel_CG5315

STRING: 7227.FBpp0083675

UniGene: Dm.11569

Protein Families
ADIPOR family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
In larval and adult brain, expressed in insulin-producing cells and in neurons of the subesophageal region. Also expressed in lateral neurons of the adult brain (at protein level). In third instar larvae, expressed in central nervous system (CNS), imagina

Q&A

What is dAdipoR (CG5315) and what is its significance in Drosophila metabolism?

dAdipoR (CG5315) is the Drosophila melanogaster adiponectin receptor with significant homology to human adiponectin receptors. It shows 66% amino acid sequence similarity to human AdipoR1 . This receptor plays a crucial role in regulating insulin secretion and controlling glucose and lipid metabolism in Drosophila melanogaster, making it an important model for studying metabolic regulation mechanisms that may have parallels in mammalian systems . The receptor is predominantly expressed in insulin-producing cells (IPCs) of larval and adult Drosophila brains, as well as in neurons of the subesophageal region and lateral neurons of the adult brain .

What are the known isoforms of dAdipoR and how do they differ?

According to research findings, dAdipoR exists in four transcript isoforms: dAdipoR A, B, C, and D. Among these, isoforms A, C, and D utilize the same start codon located in the 2nd exon of the gene, resulting in identical 444 amino acid proteins . In contrast, isoform B uses a start codon in the 4th exon, producing a shorter 362 amino acid protein . Quantitative RT-PCR analysis has revealed that isoforms A, C, and D are the predominant transcripts compared to isoform B . These isoforms show expression throughout all developmental stages from embryo to adult and are detected in various tissues including the central nervous system, imaginal disc, salivary gland, fat body, gut, and malphigian tubules of third instar larvae .

How should recombinant dAdipoR protein be reconstituted and stored for optimal stability?

For optimal reconstitution of lyophilized dAdipoR protein, it is recommended to briefly centrifuge the vial before opening to bring the contents to the bottom . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . To ensure long-term stability, 5-50% glycerol (final concentration) should be added, with 50% being the standard recommendation, and then aliquoted for long-term storage at -20°C/-80°C .

For storage, it's crucial to place the protein at -20°C/-80°C upon receipt, with aliquoting necessary for multiple use to prevent protein degradation . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as it can compromise protein integrity . The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maintain stability .

What methods are recommended for studying dAdipoR expression patterns in Drosophila tissues?

Based on research protocols, several methods have proven effective for studying dAdipoR expression patterns:

  • Immunohistochemical analysis: Using specific dAdipoR antibodies for staining larval and adult brains has successfully revealed expression in insulin-producing cells (IPCs) and neurons of the subesophageal region .

  • Co-expression studies: Confirming IPC expression through co-localization with IPCs markers, such as DsRed reporter driven by Dilp2-Gal4 (Dilp2>DsRed), provides definitive identification of cell types expressing dAdipoR .

  • Quantitative RT-PCR analysis: This technique effectively determines the relative expression levels of different dAdipoR isoforms across various tissues and developmental stages .

  • Confocal microscopy with Z-stacking: For detailed imaging of dAdipoR expression, confocal Z-stacks (1 μm step size) with identical laser power and scanning parameters, followed by image analysis using tools like Image J with Sum Slices projection type, allows for quantification of expression levels .

How can researchers effectively manipulate dAdipoR expression in vivo for functional studies?

For functional manipulation of dAdipoR expression in Drosophila, the following approaches have been successfully employed:

  • RNA interference (RNAi): Utilizing UAS-dAdipoR-RNAi constructs, such as VDRC 40936, in combination with cell-specific Gal4 drivers (e.g., Dilp2-Gal4 for IPC-specific inhibition) effectively suppresses dAdipoR expression . This approach can target all isoforms of dAdipoR transcripts simultaneously, as confirmed by quantitative RT-PCR analysis .

  • Ex vivo culture systems: Dissected brains from larvae starved on water for 20 hours can be cultured in Schneider's medium with or without human globular adiponectin at room temperature for 12 hours, followed by fixation for immunostaining . This approach allows for controlled exposure to potential ligands and assessment of resulting effects on protein secretion and signaling pathways.

  • Reporter systems: Employing constructs like UAS-secGFP or UAS-Dilp FLAG enables visualization and quantification of effects on downstream pathways following dAdipoR manipulation .

How does dAdipoR function in insulin signaling pathways compared to mammalian adiponectin receptors?

The dAdipoR in Drosophila plays a critical role in regulating insulin secretion from insulin-producing cells (IPCs), similar to the function of adiponectin receptors in mammalian systems . Research has demonstrated that IPC-specific inhibition of dAdipoR (Dilp2>dAdipoR-Ri) results in increased hemolymph sugar levels and elevated whole-body triglyceride levels, indicating impaired insulin signaling .

Interestingly, while Dilps mRNA levels in Dilp2>dAdipoR-Ri flies remain comparable to controls, there is a notable accumulation of Dilp2 protein within IPCs, accompanied by decreased levels of circulating Dilp2 and reduced insulin signaling in the fat body . This suggests that dAdipoR primarily regulates insulin secretion rather than synthesis, a mechanism potentially shared with mammalian adiponectin receptors in pancreatic beta cells.

Furthermore, ex vivo fly brain culture experiments with human adiponectin have shown that Dilp2 can be secreted from IPCs upon adiponectin exposure, indicating evolutionary conservation of the adiponectin-receptor signaling pathway between Drosophila and mammals . This conservation makes dAdipoR an excellent model for studying fundamental aspects of adiponectin receptor function that may be applicable to understanding human metabolic disorders.

What are the current technical challenges in purifying functional recombinant dAdipoR protein?

Purifying functional recombinant dAdipoR presents several technical challenges that researchers should address:

  • Membrane protein solubilization: As a seven-transmembrane domain protein (confirmed by hydropathy analysis), dAdipoR requires careful selection of detergents that effectively solubilize the protein while maintaining its native conformation and functionality .

  • Protein folding during expression: Expression in E. coli systems can result in improper folding of complex membrane proteins like dAdipoR, potentially affecting functional studies . Researchers must optimize expression conditions, including temperature, induction parameters, and host strain selection to maximize correct folding.

  • Maintaining stability post-purification: The recombinant protein requires specific buffer conditions (Tris/PBS-based buffer with 6% Trehalose at pH 8.0) and addition of glycerol (5-50%) for storage stability . The recommendation against repeated freeze-thaw cycles indicates sensitivity to temperature fluctuations that can compromise structure and function.

  • Functional validation: Confirming that the purified recombinant protein retains native binding and signaling capabilities presents challenges, as functional assays may require reconstitution into lipid bilayers or similar membrane environments to properly assess activity.

What experimental approaches could elucidate the structural determinants of ligand specificity for dAdipoR?

To investigate the structural determinants of ligand specificity for dAdipoR, researchers could implement the following experimental approaches:

  • Site-directed mutagenesis: Systematically mutating conserved residues identified through sequence alignment with human AdipoR1 (which shares 66% amino acid similarity) would help identify critical amino acids involved in ligand binding . Particular focus should be given to the predicted seven transmembrane domains identified through hydropathy analysis .

  • Chimeric receptor constructs: Creating fusion proteins between dAdipoR and human AdipoR1 by swapping corresponding domains would help determine which regions confer specificity for adiponectin binding versus potential Drosophila-specific ligands.

  • Crystallography or cryo-EM studies: Structural determination of dAdipoR alone and in complex with potential ligands would provide direct evidence of binding interfaces. Though challenging for membrane proteins, recent advances in lipid cubic phase crystallization and single-particle cryo-EM have improved success rates for such proteins.

  • Ligand binding assays: Developing fluorescence-based or radioligand binding assays with purified dAdipoR reconstituted in membrane mimetics would allow quantitative assessment of binding affinities for various ligands, including human adiponectin which has been shown to induce Dilp2 secretion in ex vivo brain cultures .

  • Molecular dynamics simulations: Computational modeling of dAdipoR structure based on homology with human AdipoR1 could predict ligand interaction sites, which could then be verified experimentally through the approaches listed above.

How can researchers address potential discrepancies between in vitro and in vivo studies of dAdipoR function?

Addressing discrepancies between in vitro and in vivo studies of dAdipoR function requires a multifaceted approach:

  • Physiological context reconstitution: In vitro studies using purified recombinant dAdipoR may lack the cellular context present in vivo. Researchers should consider employing ex vivo culture systems of dissected Drosophila brains, as demonstrated in previous studies , which better preserve the native cellular environment while allowing controlled experimental manipulation.

  • Isoform-specific analysis: Given that dAdipoR exists in multiple isoforms (A, B, C, and D) with isoform B producing a shorter protein , researchers should specify which isoform is being studied in vitro and consider whether different isoforms might have distinct functions in vivo. Quantitative comparisons of isoform expression across tissues can help interpret functional differences.

  • Comprehensive phenotypic assessment: When IPC-specific dAdipoR inhibition (Dilp2>dAdipoR-Ri) shows increased hemolymph sugar and triglyceride levels , researchers should analyze multiple metabolic parameters simultaneously to build a comprehensive phenotypic profile that can be more reliably compared with in vitro findings.

  • Cross-validation with multiple techniques: Combining biochemical assays using purified protein with genetic approaches (RNAi, overexpression) and ex vivo functional studies provides a more robust understanding of dAdipoR function and can help reconcile apparent discrepancies.

What are the implications of dAdipoR evolutionary conservation for translational research?

The high degree of evolutionary conservation between dAdipoR and human adiponectin receptors offers significant implications for translational research:

  • Model system validity: With 66% amino acid sequence similarity to human AdipoR1 , dAdipoR provides a genetically tractable model system for studying fundamental aspects of adiponectin receptor biology that may be applicable to human health and disease.

  • Conserved signaling mechanisms: The finding that human adiponectin can induce Dilp2 secretion from Drosophila IPCs in ex vivo brain cultures suggests conservation of downstream signaling pathways. This indicates that insights into dAdipoR signaling could inform understanding of human adiponectin receptor function in pancreatic beta cells.

  • Therapeutic target identification: Detailed characterization of dAdipoR function in regulating insulin secretion and metabolism in Drosophila may uncover novel regulatory mechanisms that could be targeted therapeutically in human metabolic disorders, particularly those involving insulin resistance or secretion defects.

  • Screening platform development: The Drosophila system could be developed for high-throughput screening of compounds affecting adiponectin receptor function, with promising candidates subsequently tested in mammalian systems. This approach leverages the experimental advantages of Drosophila while maintaining translational relevance.

How do different experimental conditions affect the stability and activity of recombinant dAdipoR protein?

The stability and activity of recombinant dAdipoR protein are influenced by various experimental conditions that researchers should carefully control:

Experimental ConditionEffect on StabilityEffect on ActivityRecommended Protocol
TemperatureHigher temperatures accelerate degradationTemperature shifts may affect conformation and ligand bindingStore at -20°C/-80°C long-term; working aliquots at 4°C for up to one week
Freeze-thaw cyclesRepeated cycles cause protein denaturationActivity decreases with each cycleAvoid repeated freeze-thaw; prepare single-use aliquots
Buffer compositionImproper buffer can cause aggregation or denaturationBuffer components may interfere with ligand bindingUse Tris/PBS-based buffer with 6% Trehalose, pH 8.0
Glycerol concentrationHelps prevent freezing damageMay affect protein dynamics at high concentrationsAdd 5-50% glycerol (final concentration) for storage
Protein concentrationLow concentrations are more prone to surface adsorptionActivity may be concentration-dependentReconstitute to 0.1-1.0 mg/mL in deionized sterile water

For functional studies, researchers should particularly note that as a seven-transmembrane domain protein , dAdipoR likely requires a lipid or detergent environment to maintain native conformation and activity. Additionally, the reconstitution protocol may need optimization depending on the specific experimental application, with more stringent conditions required for structural studies compared to basic binding assays.

What novel approaches could identify endogenous ligands for dAdipoR in Drosophila?

Identifying endogenous ligands for dAdipoR in Drosophila presents a significant research opportunity. Several innovative approaches could be employed:

  • Proximity labeling proteomics: Expressing dAdipoR fused to proximity labeling enzymes (BioID or APEX2) in Drosophila could identify proteins that physically interact with the receptor in vivo, potentially including endogenous ligands.

  • Hemolymph proteomics with affinity purification: Immobilizing purified recombinant dAdipoR on affinity columns and passing Drosophila hemolymph through could capture binding partners, which could then be identified by mass spectrometry.

  • Genetic screens for suppressors/enhancers: In flies with dAdipoR inhibition (Dilp2>dAdipoR-Ri) , screening for mutations that suppress or enhance the metabolic phenotypes (increased hemolymph sugar and triglyceride levels) could identify genes involved in the signaling pathway, including potential ligand genes.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking of dAdipoR in native tissue followed by immunoprecipitation and mass spectrometry could identify transiently interacting proteins, including potential ligands.

  • Comparative genomics and expression analysis: Based on the functional conservation between dAdipoR and human adiponectin receptors , comparative genomic analysis could identify Drosophila proteins with structural similarities to mammalian adiponectin, which could then be tested for binding and functional activation of dAdipoR.

How might advanced imaging techniques enhance our understanding of dAdipoR trafficking and signaling?

Advanced imaging techniques offer powerful tools for investigating dAdipoR trafficking and signaling dynamics:

  • Super-resolution microscopy: Techniques such as STORM, PALM, or STED microscopy would allow visualization of dAdipoR distribution within insulin-producing cells at nanoscale resolution, revealing potential clustering or association with specific membrane microdomains that may be important for signaling.

  • Fluorescence resonance energy transfer (FRET): By tagging dAdipoR and potential downstream signaling molecules with appropriate fluorophore pairs, FRET microscopy could detect direct molecular interactions and conformational changes during receptor activation in real-time.

  • Optogenetic manipulation: Developing light-sensitive variants of dAdipoR would enable precise temporal control of receptor activation in specific cells, allowing detailed analysis of downstream signaling dynamics and insulin secretion responses.

  • Single-molecule tracking: Labeling individual dAdipoR molecules with quantum dots or other bright, photostable fluorophores would allow tracking of receptor movement within the membrane before and after stimulation, revealing potential changes in lateral diffusion or endocytosis.

  • Correlated light and electron microscopy (CLEM): This approach could link the functional imaging of dAdipoR at the light microscopy level with ultrastructural details from electron microscopy, providing insights into how receptor distribution relates to cellular architecture in insulin-producing cells.

The combination of these advanced imaging approaches with the genetic manipulability of Drosophila and the established phenotypes of dAdipoR inhibition would provide unprecedented insights into the spatiotemporal dynamics of adiponectin receptor signaling.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.