Recombinant Drosophila melanogaster ADP,ATP carrier protein (sesB)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene and Protein Details

  • Gene Name: sesB (synonyms: ANT1, CG16944, A/A-T) .

  • Isoforms: Two splice variants, sesB-1 (ubiquitous) and sesB-2 (ovary-specific), differing by a 13-amino acid N-terminal extension .

  • Protein Size: 312 amino acids (predicted molecular weight: ~34 kDa) .

  • Host Systems: Recombinant expression in E. coli, yeast, baculovirus, and mammalian cells, with ≥85% purity confirmed by SDS-PAGE .

Cellular Impacts of sesB Dysregulation

  • ATP Levels: Principal cell-specific RNAi knockdown reduces ATP by 40%, while overexpression increases ATP availability .

  • Calcium Signaling: Mutants exhibit elevated basal cytoplasmic Ca²⁺ and impaired neuropeptide-induced Ca²⁺ responses .

  • Oxidative Stress: sesB knockdown increases mitochondrial H₂O₂ production by 2.5-fold, linked to compromised ATP synthesis .

Research Findings from Drosophila Models

Phenotypic Effects of sesB Mutations

  • Developmental Lethality: Ubiquitous overexpression (sesB-1 or sesB-2) causes 2nd instar larval lethality; RNAi knockdown results in pupal lethality .

  • Renal Dysfunction: Hypomorphic alleles show:

    • Fluid Transport Deficit: 30% reduction in Malpighian tubule secretion rates .

    • Mitochondrial Mislocalization: Disrupted mitochondrial positioning correlates with ATP depletion .

Mitochondrial Dynamics

  • Membrane Potential: JC-1 staining reveals hyperpolarized mitochondria in RNAi tubules, indicating compensatory overactivity .

  • Reactive Oxygen Species (ROS): Elevated H₂O₂ levels in sesB mutants suggest impaired ETC coordination .

Production and Applications

Recombinant Expression Systems

Expression HostAdvantagesProduct Codes
E. coliCost-effective, high yieldCSB-EP636659DLU1
BaculovirusPost-translational modificationsCSB-BP636659DLU1
Mammalian CellsNative folding and activityCSB-MP636659DLU1

Research Applications

  • Functional Studies: Reconstitution in liposomes for transport assays .

  • Antibody Production: Rabbit polyclonal antibodies validated for ELISA and Western blot .

  • Therapeutic Screening: Models for mitochondrial disorders (e.g., ANT1-linked cardiomyopathies) .

Evolutionary Conservation and Relevance

Homology with Human Proteins

Human OrthologIdentityFunctional Overlap
SLC25A4 (ANT1)78%ADP/ATP transport
SLC25A5 (ANT2)70–80%Energy metabolism

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sesB; A/A-T; CG16944; ADP,ATP carrier protein; ADP/ATP translocase; Adenine nucleotide translocator; ANT; Stress-sensitive protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
sesB
Target Protein Sequence
MGNISASITSQSKMGKDFDAVGFVKDFAAGGISAAVSKTAVAPIERVKLLLQVQHISKQI SPDKQYKGMVDCFIRIPKEQGFSSFWRGNLANVIRYFPTQALNFAFKDKYKQVFLGGVDK NTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADTGKGGQREFTGLGNCLTKIFK SDGIVGLYRGFGVSVQGIIIYRAAYFGFYDTARGMLPDPKNTPIYISWAIAQVVTTVAGI VSYPFDTVRRRMMMQSGRKATEVIYKNTLHCWATIAKQEGTGAFFKGAFSNILRGTGGAF VLVLYDEIKKVL
Uniprot No.

Target Background

Function
The ADP/ATP carrier (AAC) is an antiporter that facilitates the exchange of ADP and ATP across the inner mitochondrial membrane. This crucial function supports ATP synthesis within the mitochondrial matrix and ATP export to fuel cellular processes. The AAC operates via an alternating access mechanism, cycling between a cytoplasmic-open state (c-state) and a matrix-open state (m-state), utilizing a single substrate-binding site alternately exposed to either the cytosol or the mitochondrial matrix.
Gene References Into Functions
  1. Dcp-1 promotes autophagy by negatively regulating SesB and ATP levels. PMID: 24862573
  2. The in vivo role of the sesB (ANT1) gene in cytosolic and mitochondrial Ca2+ signaling has been characterized. PMID: 20009008
  3. sesB(org) mutation reduces biochemically assayed ANT activity, supporting a model where continuous mitochondrial ANT-dependent ATP supply is necessary for NDK-dependent activation of presynaptic dynamin during normal synaptic activity. PMID: 14668379
  4. Overexpression of the adenine nucleotide translocase (encoded by the stress-sensitive sesB gene) in Drosophila mitochondria increases proton conductance, while underexpression decreases it, even with complete carrier inhibition using carboxyatractylate. PMID: 16076285
Database Links

KEGG: dme:Dmel_CG16944

STRING: 7227.FBpp0073280

UniGene: Dm.21507

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the sesB gene and what phenotypes are associated with its mutation in Drosophila melanogaster?

The sesB gene (stress-sensitive B) in Drosophila melanogaster encodes the major adult isoform of adenine nucleotide translocase (ANT). Mutations in this gene, particularly the sesB1 point mutation, result in multiple phenotypes including developmental delay, mechanical-stress-induced seizures, impaired response to sound, defective male courtship behavior, female sterility, and curtailed lifespan. These phenotypic manifestations make sesB mutants valuable models for studying human diseases associated with ANT insufficiency .

The molecular basis of these phenotypes stems from compromised mitochondrial function. Mitochondria from sesB1 adults exhibit decreased respiratory control ratio and downregulation of cytochrome oxidase. At the organism level, this translates to ATP depletion and lactate accumulation, indicating a metabolic shift toward glycolysis as a compensatory mechanism for impaired oxidative phosphorylation .

How does sesB function differ from other nuclear-encoded mitochondrial genes in Drosophila?

The sesB gene product functions primarily as an adenine nucleotide translocase, which distinguishes it from other nuclear-encoded mitochondrial genes such as those encoding mitoribosomal proteins (e.g., tko gene encoding mitoribosomal protein S12). While both sesB1 and tko1 mutants share certain phenotypes like developmental delay and mechanical-stress-induced seizures, they differ significantly in other aspects. Unlike tko1, sesB1 mutants exhibit female sterility and severely curtailed lifespan .

The functional specificity of sesB lies in its direct role in energy metabolism through the exchange of ADP/ATP across the inner mitochondrial membrane, whereas genes like tko affect mitochondrial protein synthesis more broadly. This distinct function makes sesB mutations particularly valuable for studying energy metabolism disorders in isolation from other mitochondrial translation defects.

What experimental approaches are most effective for characterizing sesB mutant phenotypes?

Characterization of sesB mutant phenotypes requires a multi-tiered experimental approach combining organismal, cellular, and molecular analyses:

  • Organismal phenotyping: Developmental timing assays, mechanical-stress sensitivity tests, sound response assays, and lifespan measurements provide quantitative assessment of whole-organism phenotypes.

  • Bioenergetic profiling: Isolation of mitochondria followed by respirometry to measure oxygen consumption rates and respiratory control ratios. This approach directly quantifies the functional impairment of oxidative phosphorylation.

  • Biochemical analyses: Measurement of ATP levels, lactate accumulation, and enzymatic activities of glycolytic and TCA cycle components to assess metabolic adaptations.

  • Gene expression analysis: Transcriptome profiling to identify genes with altered expression, particularly those involved in metabolic pathways that might compensate for mitochondrial dysfunction .

These methodologies, when applied systematically, provide a comprehensive picture of how sesB mutations affect cellular physiology and organism development.

What are the most effective genetic rescue strategies for sesB mutant phenotypes?

Research indicates two primary strategies for rescuing sesB mutant phenotypes:

  • Altered mitochondrial DNA background: Evidence suggests that specific mitochondrial DNA configurations can alleviate the developmental delay and mechanical-stress-induced seizures in sesB1 mutants. This approach leverages the nuclear-mitochondrial genetic interactions to compensate for the defects caused by sesB mutation .

  • Alternative oxidase (AOX) expression: Somatic expression of alternative oxidase from the sea squirt Ciona intestinalis substantially rescues female sterility in sesB1 mutants. Interestingly, AOX does not alleviate developmental delay, suggesting pathway-specific rescue effects .

Rescue StrategyDevelopmental DelayMechanical-Stress SeizuresFemale SterilityLifespan Extension
Altered mtDNAEffectiveEffectiveMinimal effectNot reported
AOX ExpressionNot effectiveNot reportedSubstantially effectiveNot reported

These findings highlight the importance of targeted therapeutic approaches that address specific aspects of the complex phenotype rather than seeking universal rescue strategies.

How can one design effective experimental protocols to study the metabolic shift in sesB mutants?

Designing effective protocols to study the metabolic shift in sesB mutants requires a comprehensive approach integrating multiple techniques:

  • Metabolic flux analysis: Use isotope-labeled glucose (e.g., 13C-glucose) to track carbon flow through glycolysis, TCA cycle, and related pathways. This approach allows quantification of how carbon is redistributed in response to impaired oxidative phosphorylation.

  • Real-time metabolic measurements: Employ the Seahorse XF Analyzer to measure extracellular acidification rate (ECAR) and oxygen consumption rate (OCR) simultaneously, providing direct evidence of glycolytic upregulation.

  • Enzymatic activity assays: Measure activities of key glycolytic enzymes (particularly lactate dehydrogenase) and anaplerotic pathway enzymes to identify specific metabolic adaptations.

  • Transcriptional profiling: Analyze expression changes in metabolic genes using RNA-Seq or targeted qPCR to identify the molecular basis of the metabolic shift .

What are the molecular mechanisms underlying the differential response to rescue strategies in sesB mutants?

The differential response to rescue strategies in sesB mutants likely stems from the complex interplay between energy metabolism and tissue-specific requirements. To investigate these mechanisms:

  • Pathway analysis: Compare transcriptomes of wild-type, sesB mutants, and rescued flies to identify pathways differentially affected by various rescue strategies. Focus on energy metabolism, stress response, and developmental pathways.

  • Tissue-specific rescue experiments: Use the GAL4-UAS system to express rescue constructs in specific tissues to determine which tissues are most critical for different phenotypic manifestations.

  • Metabolomic profiling: Analyze metabolite levels in different tissues to identify tissue-specific metabolic signatures that might explain the differential response to rescue strategies.

  • Functional interaction mapping: Use genetic interaction screens to identify genes that modify specific sesB phenotypes, providing insights into the molecular networks underlying each phenotypic manifestation .

These approaches can reveal why alternative oxidase expression effectively rescues female sterility but not developmental delay, informing more targeted therapeutic strategies.

How should researchers design controlled behavioral experiments to assess sesB mutant phenotypes?

Designing controlled behavioral experiments for sesB mutants requires careful consideration of variables and appropriate controls:

  • Mechanical stress sensitivity: Design a standardized mechanical disturbance protocol (e.g., vortexing flies in vials for defined periods) and record recovery time or seizure duration. Include age-matched wild-type controls and, ideally, other mitochondrial mutants for comparison.

  • Sound response assays: Utilize calibrated sound stimuli at various frequencies and intensities, measuring startle responses or habituation. Implement between-subjects design with appropriate controls .

  • Courtship behavior: Record and analyze courtship behaviors using established metrics (courtship index, latency to court, copulation success rate). Control for age, circadian timing, and experimental environment.

  • Developmental timing: Track developmental milestones (pupation, eclosion) under standardized temperature and nutrition conditions. Implement statistical analysis accounting for natural variation.

For all behavioral experiments, researchers should:

  • Define primary variables (independent: genotype; dependent: specific behavioral metrics)

  • Control extraneous variables (temperature, humidity, circadian time, age, nutrition)

  • Use sufficient sample sizes based on power analysis

  • Implement blinded scoring to prevent observer bias

  • Apply appropriate statistical tests for data analysis

What are the optimal conditions for expressing and purifying recombinant Drosophila sesB protein?

The optimal conditions for expressing and purifying recombinant Drosophila sesB protein require careful consideration of multiple factors:

  • Expression system selection: For functional studies, a eukaryotic expression system is preferred due to the need for proper folding and post-translational modifications. Insect cell lines (Sf9, S2) provide an appropriate cellular environment for Drosophila proteins.

  • Construct design:

    • Include a cleavable affinity tag (His6 or GST) for purification

    • Optimize codon usage for the expression system

    • Consider expressing a stabilized variant lacking hydrophobic transmembrane domains if full-length protein expression is challenging

  • Expression conditions:

    • Temperature: 25-28°C for insect cells

    • Induction duration: 48-72 hours for optimal protein accumulation

    • Media supplementation: Consider adding mitochondrial substrate analogs to enhance stability

  • Purification protocol:

    • Membrane solubilization: Use mild detergents (DDM, LMNG) to extract the protein while maintaining its native conformation

    • Affinity chromatography: Using the tagged construct

    • Size exclusion chromatography: To separate aggregates and ensure homogeneity

    • Maintain reducing conditions throughout purification to prevent oxidation of critical cysteine residues

This approach has been successfully employed for related mitochondrial carrier family proteins and can be adapted specifically for sesB.

How can researchers effectively investigate the interaction between sesB and other mitochondrial components?

Investigating interactions between sesB and other mitochondrial components requires a multi-faceted approach:

  • Co-immunoprecipitation (Co-IP): Use antibodies against sesB or an epitope-tagged version to pull down protein complexes from mitochondrial extracts. Analyze interacting partners by mass spectrometry.

  • Proximity labeling: Employ BioID or APEX2 fusion constructs with sesB to identify proteins in close proximity within the mitochondrial environment. This approach is particularly valuable for identifying transient interactions.

  • Genetic interaction screening: Systematically test genetic interactions between sesB and other mitochondrial genes through double-mutant analysis or RNAi screening. Synthetic lethal or rescue interactions can reveal functional relationships.

  • Mitochondrial sub-compartment fractionation: Separate mitochondrial membranes and soluble fractions to determine the precise localization of sesB and potential interacting partners.

  • Blue native PAGE: Analyze intact mitochondrial complexes to determine if sesB forms part of larger protein assemblies beyond its primary role in ADP/ATP exchange.

These approaches can reveal how sesB functions within the broader context of mitochondrial biology and identify potential points of intervention for therapeutic strategies.

How should researchers analyze and interpret conflicting data on sesB function across different experimental systems?

Analyzing conflicting data on sesB function requires a systematic approach to reconcile apparent contradictions:

  • System-specific context analysis: Compare experimental parameters across studies, including genetic background, developmental stage, tissue specificity, and environmental conditions. Document these in a comparative table:

StudyGenetic BackgroundDevelopmental StageTissueEnvironmental ConditionsKey Findings
Study 1w1118AdultBrain25°C, standard media[Finding 1]
Study 2Oregon-RLarvalMuscle29°C, sugar-enhanced media[Finding 2]
  • Methodological reconciliation: Evaluate differences in methodological approaches that might explain discrepancies, including:

    • Protein extraction methods

    • Assay sensitivities and detection limits

    • Temporal resolution of measurements

    • Statistical approaches and power

  • Biological validation strategies:

    • Perform reciprocal experiments using methodologies from conflicting studies

    • Test hybrid approaches that combine elements from different experimental systems

    • Develop new assays that might resolve contradictions

  • Statistical meta-analysis: Where appropriate, perform quantitative meta-analysis of results across studies to identify patterns that might not be apparent in individual studies .

By systematically analyzing these factors, researchers can often identify the source of conflicting results and develop a more comprehensive understanding of sesB function.

What statistical approaches are most appropriate for analyzing the complex phenotypic data from sesB mutants?

The complex phenotypic data from sesB mutants requires sophisticated statistical approaches:

  • Multivariate analysis: Apply principal component analysis (PCA) or non-metric multidimensional scaling to identify patterns in complex phenotypic datasets. This approach can reveal relationships between seemingly unrelated phenotypes .

  • Mixed-effects modeling: Use linear mixed-effects models to account for both fixed effects (genotype, treatment) and random effects (individual variability, experimental batch). This approach is particularly valuable for longitudinal data such as development timing or lifespan studies.

  • Survival analysis: Apply Kaplan-Meier survival curves and Cox proportional hazards models for lifespan data, allowing for censored observations and covariates.

  • Bayesian approaches: Implement Bayesian statistical methods to incorporate prior knowledge and handle small sample sizes common in complex phenotypic studies.

  • Multiple testing correction: Apply appropriate corrections (Bonferroni, Benjamini-Hochberg) when analyzing multiple phenotypes to control false discovery rates.

For example, when analyzing developmental timing, mechanical stress sensitivity, and ATP levels simultaneously, a multivariate approach can reveal whether these phenotypes cluster together or vary independently, providing insights into underlying mechanistic relationships.

How can researchers effectively integrate multi-omics data to understand sesB function and its effects on cellular metabolism?

Integrating multi-omics data to understand sesB function requires systematic data collection, normalization, and integration:

  • Data collection strategy:

    • Transcriptomics: RNA-Seq to identify gene expression changes

    • Proteomics: MS-based quantitative proteomics focusing on mitochondrial proteins

    • Metabolomics: Targeted and untargeted approaches to identify metabolic signatures

    • Lipidomics: Analysis of membrane lipid composition, particularly in mitochondria

  • Normalization and quality control:

    • Apply platform-specific normalization methods

    • Implement batch correction algorithms

    • Filter low-quality measurements

    • Validate key findings with orthogonal techniques

  • Integration approaches:

    • Network-based integration using weighted gene co-expression network analysis (WGCNA)

    • Pathway enrichment across multiple omics layers

    • Metabolic flux analysis constrained by transcriptomic and proteomic data

    • Machine learning approaches to identify patterns across datasets

  • Visualization and interpretation:

    • Develop integrated visualizations that show connections between different omics layers

    • Focus on convergent pathways identified across multiple datasets

    • Validate key nodes through targeted experimental manipulation

This integrative approach can reveal how sesB mutation propagates from altered gene expression to protein changes and ultimately to metabolic rewiring, providing a systems-level understanding of mitochondrial dysfunction.

What is the potential of alternative oxidase (AOX) expression as a therapeutic strategy for human diseases related to ANT dysfunction?

The potential of alternative oxidase (AOX) as a therapeutic strategy for human ANT-related diseases stems from its demonstrated efficacy in rescuing specific sesB mutant phenotypes in Drosophila:

Despite these challenges, the specific rescue of female sterility in sesB mutants provides proof-of-concept that targeted bypass of respiratory chain components can mitigate specific consequences of ANT dysfunction, warranting further investigation as a therapeutic strategy.

How can the Drosophila sesB model be effectively used to screen for potential therapeutic compounds?

The Drosophila sesB model offers an efficient platform for screening therapeutic compounds targeting ANT dysfunction:

  • High-throughput screening approach:

    • Primary screen: Survival and developmental timing in sesB mutants exposed to compound libraries

    • Secondary screen: Specific phenotypic assays (mechanical stress response, female fertility)

    • Tertiary screen: Biochemical validation (ATP levels, mitochondrial function)

  • Compound categories to prioritize:

    • Metabolic modulators (particularly those affecting glycolysis)

    • Mitochondrial biogenesis inducers

    • Redox modulators

    • Compounds affecting mitochondrial dynamics (fusion/fission)

  • Screening protocol optimization:

    • Standardize developmental stage and feeding approach

    • Determine optimal compound concentration ranges

    • Establish clear positive controls (e.g., AOX expression) and negative controls

    • Implement appropriate statistical analysis for hit identification

  • Validation pipeline:

    • Confirm hits in secondary Drosophila models

    • Test promising compounds in mammalian cell models of ANT deficiency

    • Evaluate pharmacokinetics and tissue distribution

    • Assess potential off-target effects

This systematic approach leverages the genetic tractability and relatively low cost of Drosophila while maintaining translational relevance to human ANT-related disorders.

What are the key considerations for developing gene therapy approaches targeting sesB-related pathologies?

Developing gene therapy approaches for sesB-related pathologies requires addressing several critical considerations:

  • Vector selection and optimization:

    • AAV vectors show promise for mitochondrial targeting

    • Lentiviral vectors may be appropriate for ex vivo approaches

    • Vector capacity must accommodate the ANT coding sequence plus regulatory elements

    • Tissue-specific promoters should be selected based on disease manifestation

  • Therapeutic gene design:

    • Wild-type ANT gene vs. engineered variants with enhanced stability

    • Codon optimization for expression in target tissues

    • Inclusion of mitochondrial targeting sequences

    • Consideration of epitope tags for tracking (balanced against functional impact)

  • Delivery challenges:

    • Blood-brain barrier penetration for neurological manifestations

    • Cardiac delivery for cardiomyopathy presentations

    • Sufficient transduction efficiency in target tissues

    • Potential immune responses to vectors or transgene products

  • Efficacy assessment:

    • Functional restoration of ADP/ATP exchange

    • Correction of downstream metabolic abnormalities

    • Phenotypic improvement in animal models

    • Biomarker development for clinical translation

  • Safety considerations:

    • Potential for insertional mutagenesis with integrating vectors

    • Off-target effects of overexpression

    • Immunogenicity of vector components

    • Long-term safety monitoring requirements

These considerations highlight the complexity of developing gene therapy approaches for mitochondrial disorders but also provide a roadmap for systematic development and evaluation of potential therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.