Recombinant Drosophila melanogaster Alkaline ceramidase (bwa)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. To avoid degradation, minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
bwa; CG13969; Alkaline ceramidase; AlkCDase; Alkaline N-acylsphingosine amidohydrolase; Alkaline acylsphingosine deacylase; Protein brainwashing
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
bwa
Target Protein Sequence
MGGMGGGGLLDIYAMAWEHLRPGSSPVDWCEGNYLISSNIAEFVNTFSNFLFILLPPVLI MLFKEYGRFVTPGIHVIWVLLIVVGLSSMYFHATLSLIGQLLDELAILWVFMAAFSLFYP KRYYPKFVKNDRKTFSWLMLLSAIAATGLSWWKPIVNAFVLMFMSVPTMVMLYTELQRVS DQRVYRLGIRSTTVWAVAVFCWINDRIFCEAWSSINFPYLHGFWHIFIFIAAYTVLVLFA YFYVESELPQRQPLLKYWPKNEFEFGIPFISIRNPGKALRNTI
Uniprot No.

Target Background

Function
Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid.
Gene References Into Functions
  1. A study demonstrated that BWA does not exhibit ceramidase activity. While BWA is unlikely to be a ceramidase, it serves as a regulator of sphingolipid flux. Bwa exhibits strong genetic interactions with other genes encoding ceramide-metabolizing enzymes. PMID: 21148295
Database Links

KEGG: dme:Dmel_CG13969

STRING: 7227.FBpp0303611

UniGene: Dm.14445

Protein Families
Alkaline ceramidase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the central midgut of late embryos. In brain, it is present at the interhemispheric junction and in groups of cells in the central brain.

Q&A

What is Drosophila melanogaster alkaline ceramidase (Dacer/bwa) and what is its function?

Drosophila alkaline ceramidase (Dacer) is the protein product of the brainwashing (bwa) gene that catalyzes the hydrolysis of ceramides to generate sphingosine (SPH) and fatty acids. It is a membrane-bound protein of 284 amino acids that shares homology with yeast and mammalian alkaline ceramidases. Dacer plays a crucial role in the metabolism of ceramides in Drosophila, affecting development, lifespan, and oxidative stress resistance .

The enzyme contains five putative transmembrane domains and functions optimally at alkaline pH (around pH 8.0). Unlike mammals that express three alkaline ceramidase genes, Drosophila melanogaster has only one alkaline ceramidase gene (Dacer/bwa), making it an excellent model for studying the physiological roles of alkaline ceramidases .

Where and when is Dacer/bwa expressed during Drosophila development?

Dacer mRNA exhibits both temporal and spatial expression patterns:

Tissue distribution:

  • Highest expression in the midgut

  • Moderate expression in the brain

  • Low expression in other organs

Developmental stages:

  • Significantly upregulated during the pupal stage compared to larval or adult stages

This expression pattern suggests Dacer plays important developmental roles, particularly during metamorphosis when extensive tissue remodeling occurs .

How does Dacer inactivation affect ceramide levels in Drosophila?

Inactivation of Dacer through insertional mutagenesis (bwa^e02081) results in significant increases in ceramide levels in both pupae and adult flies. Specifically:

  • Dacer mutant pupae show elevated levels of most ceramide species containing either C14-sphingosine or C16-sphingosine

  • Similar increases in ceramide levels are observed in adult mutant flies

  • Interestingly, despite increased ceramide levels, free sphingoid base levels remain unchanged, suggesting potential compensatory mechanisms through other ceramidases or decreased conversion of sphingoid bases to their phosphates

What are the optimal conditions for expressing recombinant Dacer for in vitro studies?

For optimal expression and enzymatic activity of recombinant Dacer:

  • Expression system: Baculovirus expression system in High Five insect cells provides good yields of functional enzyme

  • Vector construction: Clone the Dacer coding sequence into a baculoviral vector (pFastBacHT B) with a 6xHIS tag for easy purification and detection

  • Protein localization: Isolate microsomes from transfected cells, as Dacer is a membrane-bound protein

  • Activity assay conditions:

    • Buffer pH: 8.0 (optimal for enzymatic activity)

    • Substrate: Various ceramide species (d-e-C6 to d-e-C24:1-ceramide)

    • Detection method: Mass spectrometry to quantify ceramide hydrolysis

How can Dacer enzyme activity be measured in vitro?

Methodological approach for measuring Dacer activity:

  • Microsome preparation:

    • Isolate microsomes from cells expressing recombinant Dacer

    • Use microsomes from cells transfected with empty vector as control

  • Reaction conditions:

    • Buffer: Typically at pH 8.0 (alkaline range)

    • Substrate: Various ceramide species (natural or synthetic)

    • Incubation time: Typically 30-60 minutes at 37°C

  • Activity measurement:

    • Quantify sphingosine release using mass spectrometry

    • Calculate specific activity by subtracting endogenous ceramidase activity (from control microsomes) from total ceramidase activity in Dacer-expressing microsomes

  • pH profile determination:

    • Test activity across a range of pH values (6.0-10.0) to determine optimal pH

    • The recombinant Dacer exhibits highest activity at pH 8.0

What is the substrate specificity of Drosophila alkaline ceramidase?

Recombinant Dacer shows activity toward multiple ceramide substrates with different fatty acyl chain lengths:

Relative activity on different ceramide species:

  • Active against d-e-C6, d-e-C12, d-e-C16, d-e-C18, and d-e-C24:1-ceramide

  • Shows approximately twofold increase in ceramidase activity compared to control microsomes when tested at pH 9.0

This broad substrate specificity suggests Dacer can hydrolyze various ceramide species in vivo, though it may have preferences for specific ceramide structures .

How can Dacer mutants be generated and validated in Drosophila melanogaster?

Generation and validation of Dacer mutants:

  • Mutant acquisition:

    • Use established mutant lines like bwa^e02081 available from the Bloomington Drosophila Stock Center

    • This mutant contains a P-element insertion in the 4th exon of the Dacer/bwa gene

  • Validation methods:

    • Genetic verification: PCR genotyping to confirm P-element insertion

    • Transcriptional analysis: RT-PCR or qRT-PCR to assess Dacer mRNA levels

    • Functional validation: Measure ceramidase activity in mutant vs. wild-type flies

    • Biochemical confirmation: Quantify ceramide levels using ESI/MS/MS to demonstrate increased ceramide accumulation in mutants

  • Maintenance:

    • Keep stocks at 25°C on a 12:12 h light:dark cycle

    • Use standard cornmeal medium (8.6% sucrose, 1% yeast, 11.3% cornmeal, 1% agar, and 1% propionic acid)

What phenotypes are associated with Dacer/bwa mutations in Drosophila?

Dacer/bwa mutations result in several distinct phenotypes:

  • Developmental effects:

    • Delayed pre-adult development time

    • Abnormal mushroom body structure in the brain (fusion of beta lobes in central brain)

  • Lifespan:

    • Significantly extended lifespan compared to wild-type flies

  • Stress resistance:

    • Increased resistance to oxidative stress

    • Lower mitochondrial ROS production during aging and when challenged with paraquat-induced oxidative stress

  • Metabolic changes:

    • Elevated ceramide levels in both pupae and adults

    • Slower decline in ATP levels during aging, suggesting better maintenance of mitochondrial function

How do ceramide levels correlate with lifespan and stress resistance in Dacer mutants?

In Dacer mutant flies:

  • Ceramide accumulation and lifespan:

    • Inactivation of Dacer causes significant increases in ceramide levels

    • Mutant flies exhibit extended lifespan compared to wild-type controls

    • This suggests increased ceramides may contribute to longevity, contradicting the traditional view that ceramide accumulation is detrimental

  • Oxidative stress mechanism:

    • Mutant flies show reduced mitochondrial ROS production during aging

    • The difference in ROS production becomes more pronounced when flies are challenged with oxidative stress (paraquat)

    • ATP levels decline more slowly during aging in mutant flies

    • This suggests ceramide accumulation somehow protects mitochondrial function by reducing ROS production

  • Evolutionary conservation:

    • Similar phenotypes (increased lifespan with ceramidase inactivation) have been observed in yeast mutants deficient in the alkaline ceramidase YDC1

    • This indicates the role of alkaline ceramidase in controlling lifespan is conserved from lower to higher eukaryotes

How does Dacer function differ from mammalian alkaline ceramidases?

Comparative analysis between Drosophila and mammalian alkaline ceramidases:

  • Sequence homology:

    • Dacer shows 35%, 46%, and 26% protein sequence identity to human alkaline ceramidases ACER1, ACER2, and ACER3, respectively

    • Highest similarity to ACER2 in both sequence and pH optimum

  • Substrate specificity differences:

    • Mammalian ACER1: Prefers very long-chain ceramides

    • Mammalian ACER2: Broad substrate specificity (similar to Dacer)

    • Mammalian ACER3: Prefers unsaturated ceramides

    • Dacer: Shows activity against multiple ceramide species

  • Tissue distribution:

    • Mammalian ceramidases: Tissue-specific expression patterns

    • Dacer: Highest expression in midgut, moderate in brain

  • Evolutionary significance:

    • Mammals express three alkaline ceramidase genes with specialized functions

    • Drosophila has only one alkaline ceramidase gene (Dacer)

    • This simplicity makes Drosophila an excellent model for studying the fundamental roles of alkaline ceramidases before evolutionary diversification

What is the relationship between Dacer activity, ceramide metabolism, and oxidative stress resistance?

Mechanism connecting ceramide metabolism and stress resistance:

  • Oxidative stress parameters:

    • Dacer mutants show significantly lower mitochondrial ROS production compared to wild-type flies

    • This difference becomes more pronounced with aging and under paraquat-induced oxidative stress

    • ATP levels decline more slowly in Dacer mutants during aging

  • Proposed mechanism:

    • Increased ceramide levels in Dacer mutants somehow reduce mitochondrial ROS production

    • Lower ROS production leads to reduced oxidative damage to mitochondria

    • Better preserved mitochondrial function results in maintained ATP production during aging

    • This ultimately contributes to extended lifespan and increased stress resistance

  • Ceramide species specificity:

    • Different ceramide species may have distinct effects on oxidative stress

    • The specific ceramide species that accumulate in Dacer mutants (containing C14SPH or C16SPH) may be particularly protective against oxidative damage

How can recombinant Dacer be used as a tool to study ceramide-dependent signaling pathways?

Research applications for recombinant Dacer:

  • Manipulating ceramide levels in vitro:

    • Express recombinant Dacer in cell culture systems to reduce ceramide levels

    • Use as a tool to investigate ceramide-dependent signaling pathways

    • Compare effects with specific ceramidase inhibitors

  • Structure-function studies:

    • Generate Dacer variants with mutations in conserved domains

    • Analyze effects on enzyme activity, substrate specificity, and pH sensitivity

    • Identify critical residues involved in catalysis

  • Pathway analysis:

    • Use recombinant Dacer in combination with lipidomics to track ceramide metabolism

    • Identify downstream effects of ceramide hydrolysis on sphingosine and sphingosine-1-phosphate levels

    • Map ceramide-dependent signaling networks by comparing wild-type and catalytically inactive Dacer

  • Therapeutic implications:

    • Screen for compounds that modulate Dacer activity

    • Investigate whether manipulating ceramidase activity could influence lifespan or stress resistance in other models

    • Explore potential applications for age-related diseases involving oxidative stress

What are common challenges in expressing and purifying active recombinant Dacer?

Common challenges and solutions:

  • Protein solubility issues:

    • Challenge: As a membrane protein with multiple transmembrane domains, Dacer can aggregate during expression

    • Solution: Express in insect cell systems (High Five cells) rather than bacterial systems

    • Solution: Isolate microsomes rather than attempting full purification of the solubilized protein

  • Activity preservation:

    • Challenge: Loss of enzymatic activity during purification

    • Solution: Optimize detergent type and concentration for solubilization

    • Solution: Include appropriate protease inhibitors during all steps

    • Solution: Maintain alkaline pH conditions during handling

  • Expression levels:

    • Challenge: Low expression yields

    • Solution: Optimize codon usage for the expression system

    • Solution: Use strong promoters and optimal cell culture conditions

    • Solution: Consider adding tags that enhance protein folding or stability

How can ceramide levels be accurately measured in Drosophila tissues?

Methodological approach for ceramide quantification:

  • Sample preparation:

    • Collect tissue samples (whole flies, specific organs, or developmental stages)

    • Homogenize samples in appropriate buffer

    • Extract lipids using chloroform/methanol extraction methods

    • Prepare samples according to mass spectrometry requirements

  • Analytical methods:

    • ESI/MS/MS (Electrospray Ionization Tandem Mass Spectrometry): Primary method used for quantitative analysis of ceramide species

    • Advantages: High sensitivity, ability to distinguish between different ceramide species based on sphingoid base and fatty acid composition

  • Standards and controls:

    • Include internal standards (e.g., C17-ceramide) for quantification

    • Use both positive and negative controls to validate extraction efficiency

    • Run samples in technical and biological replicates

  • Data analysis:

    • Normalize ceramide levels to total phospholipid content or tissue weight

    • Identify and quantify individual ceramide species based on their characteristic mass transitions

    • Compare ceramide profiles between experimental groups

What considerations are important when studying Dacer in different developmental stages of Drosophila?

Stage-specific considerations:

  • Embryonic stage:

    • Challenge: Limited material for biochemical analyses

    • Solution: Pool large numbers of embryos

    • Consideration: Potential maternal contribution of Dacer

  • Larval stage:

    • Challenge: Different tissues may have varying Dacer expression

    • Solution: Dissect specific tissues when possible

    • Consideration: Diet effects on ceramide metabolism

  • Pupal stage:

    • Challenge: High natural variation in ceramide levels during metamorphosis

    • Solution: Precise staging of pupae (e.g., hours after puparium formation)

    • Consideration: Highest Dacer expression occurs during this stage, suggesting critical developmental functions

  • Adult stage:

    • Challenge: Age-dependent changes in ceramide metabolism

    • Solution: Use age-matched flies for experiments

    • Consideration: Sex differences in ceramide metabolism

    • Consideration: Ensure consistent rearing conditions (25°C, 12:12 h light:dark cycle, standard cornmeal medium)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.