Recombinant Drosophila melanogaster Atlastin (atl)

Shipped with Ice Packs
In Stock

Description

Introduction

Atlastins are a family of dynamin-like GTPases that are present in the genomes of vertebrates, invertebrates, yeasts, and plants . Drosophila melanogaster has a single atlastin homolog (dAtl) . Atlastin (ATL) mediates the homotypic fusion of endoplasmic reticulum (ER) membranes and is required for ER network formation .

Structure and Function

Drosophila Atlastin (atl) is 541 amino acids long with a predicted molecular mass of 61 kDa . Both human and Drosophila atlastin hydrophobic membrane anchors form two intramembrane hairpin loops instead of spanning the membrane . Atlastin resides in the ER, enabling it to mediate interactions between ER membranes . It is likely that Atlastin requires GTPase activity to function .

Expression and Localization

Immunohistochemistry experiments have demonstrated that Drosophila Atlastin is ubiquitously expressed, with high expression levels during embryonic development . In embryos, Atlastin immunoreactivity consistently overlaps with the ER-reporter green fluorescent protein (GFP)-KDEL and the ER-localized proteins BiP and Rtnl1-GFP . Atlastin does not share the punctate distribution typical of the Golgi apparatus in Drosophila . Quantitative immunogold electron microscopy (EM) analysis in Drosophila S2 cells showed that approximately 60% of gold particles were found on ER membranes .

Functional Interactions

Defects in synaptic transmission in Drosophila caused by the loss of dAtl can be partially rescued by the additional loss of Rtnl1, suggesting functional interaction in vivo .

Role in ER Fusion

Combined in vivo and in vitro analyses provide evidence that Atlastin is a vital GTPase required for homotypic fusion of ER membranes . In response to loss of atlastin, the ER network becomes fragmented, supporting a function in the maintenance of ER integrity . Atlastin is capable of homo-oligomerization, and self-association can occur within the same membrane and between opposing membranes, leading to the formation of trans-complexes that tether adjacent ER membranes . Overexpression of Atlastin in vivo results in the expansion of ER elements, consistent with excessive membrane fusion, and recombinant Atlastin drives membrane fusion in vitro in a GTP-dependent manner .

Impact on Motor Neuron Function

Downregulation or overexpression of Atlastin in motor neurons results in decreased crawling speed and contraction frequency in larvae .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, customers may request a specific tag type; we will prioritize its development upon request.
Synonyms
atl; CG6668; Atlastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-541
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
atl
Target Protein Sequence
MGGSAVQVINASEEHTFVLNEDALSEVLMRDEVKDRFVCVVSVAGAFRKGKSFLLDFFLR YMYSKYVHHDATDWLGGESDPLEGFSWRGGSERDTTGILMWSDIFLHDYPNGDKIAIILL DTQGAFDSQSTVRDCATVFALSTMLSSVQIYNLSQNIQEDDLQHLQLFTEYGRLALADTG KKPFQRLQFLVRDWSFPYEAEYGALGGDKILKRRLEVSDKQHPELQSLRRHISSCFTEVA CFLMPHPGLNVATNPKFDGRLQDITPEFKSSLRSLVPMLLAPDNLVYKEISGQRVRARDL IQYFQSYMNIYKGNELPEPKSMLVATAEANHLTAVAAAKELYGQLMEEVCGGTRPYLSTA HLQTEHLRVKDKALFQFAAKRKMGGEEFTEKFRKQLEDDLEEVFTNYQAHNESKNIFKAA RTPAVYFACAVIMYILSGIFGLVGLYTFANFCNLVMGVALLTLALWAYIRYSGELSDFGG KLDDFATLLWEKFMRPIYHGCMEKGIHHVATHATEMAVGGGAASYRSQTSVNASNGKVKR S
Uniprot No.

Target Background

Function
Atlastin is a GTPase that tethers membranes by forming trans-homooligomers and mediating homotypic fusion of endoplasmic reticulum membranes. It plays a crucial role in endoplasmic reticulum tubular network biogenesis and may also regulate microtubule polymerization and Golgi biogenesis. It is essential for the survival of dopaminergic neurons and the development of muscles and synapses at neuromuscular junctions.
Gene References Into Functions
  1. Trafficking defects caused by Atlastin dysfunction in motor neurons lead to redistribution of presynaptic components and aberrant synaptic vesicle mobilization. PMID: 28860117
  2. This study demonstrates Atlastin's requirement in motor neurons for proper transmitter release. PMID: 26906425
  3. Purified and reconstituted human ATL1 showed no in vitro fusion activity. However, when the cytosolic segment of human ATL1 was linked to the transmembrane (TM) region and C-terminal tail (CT) of Drosophila ATL, fusion activity was observed. PMID: 25407413
  4. Expression of either the K320E or E328R Atlastin GTPase (D-ATL) variant resulted in dominant-negative disruptions of the endoplasmic reticulum. PMID: 25253720
  5. GTP hydrolysis is necessary for Atlastin-mediated vesicle tethering. PMID: 25825753
  6. The C-terminal tail of Atlastin destabilizes bilayers locally to facilitate membrane fusion. PMID: 25555915
  7. Atlastin mediates homotypic fusion of endoplasmic reticulum membranes through lipid interaction with its C-terminus and association of its transmembrane segments. PMID: 22802620
  8. Increasing the distance of Atlastin complex formation from the membrane inhibits fusion, indicating the importance of this distance in promoting fusion. PMID: 21930898
  9. Atlastin dimerizes in the presence of GTPγS but exists as a monomer with GDP or without nucleotide. Oligomerization, as well as efficient GTPase activity, requires the juxtamembrane middle domain three-helix bundle. PMID: 21690399
  10. Loss of Atlastin, a spastic paraplegia gene, induces age-dependent death of dopaminergic neurons in Drosophila. PMID: 17030474
  11. Atlastin regulates synapse development, ER, and Golgi morphogenesis by modulating microtubule stability. PMID: 19341724
  12. Atlastin mediates membrane tethering and fusion, and its GTPase activity is crucial for endoplasmic reticulum homotypic fusion. PMID: 19633650
Database Links

KEGG: dme:Dmel_CG6668

STRING: 7227.FBpp0084036

UniGene: Dm.31277

Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Note=Colocalizes with microtubules (PubMed:19341724).
Tissue Specificity
Ubiquitously expressed.

Q&A

What is the domain organization of Drosophila Atlastin and how does it compare to human Atlastin isoforms?

Drosophila melanogaster has a single atlastin (atl) gene that encodes a protein of 541 amino acids with a predicted molecular mass of 61 kDa. The domain organization includes:

  • An N-terminal GTPase domain

  • A middle three-helix bundle (3HB) domain

  • Two transmembrane domains

  • A C-terminal cytoplasmic tail

Drosophila atl shows high homology with all three human isoforms, ranging between 44% and 49% identical (61% and 68% similar) over the entire length of the protein. The homology improves significantly (55-59% identity) when excluding the highly variable N-terminal (17-45 residues) and C-terminal (29-50 residues) regions . This conservation makes Drosophila an excellent model organism for studying atlastin function relevant to human disease.

What are the essential functional regions of Drosophila Atlastin required for membrane fusion?

Multiple regions of Atlastin are critical for its membrane fusion activity:

  • GTPase domain: Absolutely required for membrane fusion, as GTPase activity is essential for the fusion process .

  • Three-helix bundle (3HB) middle domain: Necessary for oligomerization and efficient GTPase activity. Mutations disrupting the structure of helices within the 3HB inactivate atlastin by preventing tethering and subsequent fusion of ER membranes .

  • Transmembrane domains: At least one transmembrane anchor is necessary but not sufficient for fusion activity .

  • C-terminal cytoplasmic domain: A conserved region (residues 471-497) of the C-terminal cytoplasmic tail is absolutely required for fusion activity. Truncations removing this region abolish fusion activity despite retaining GTPase activity at rates within ~30% of wild-type rates .

The functional interdependence of these domains is demonstrated by the fact that reintroduction of the conserved juxtamembrane region (residues 471-497) to a C-terminal truncation mutant restores ~70% of wild-type fusion activity .

What expression systems are most effective for producing functional recombinant Drosophila Atlastin?

Based on the research literature, several expression systems have been successfully used for producing functional recombinant Drosophila Atlastin:

  • Bacterial expression (E. coli): Effective for producing Atlastin for in vitro studies. The protein can be reconstituted into synthetic phosphatidylcholine:phosphatidylserine (PCPS) liposomes to measure membrane fusion by lipid mixing .

  • Mammalian cell expression (Cos7 cells): Useful for in vivo studies of Atlastin function. When functional Atlastin is expressed in Cos7 cells, it correctly localizes to the ER, causes formation of an enlarged ER compartment, and redistributes Golgi-resident proteins to the ER, providing a clear phenotypic readout of protein activity .

  • Transgenic Drosophila expression: The most physiologically relevant system. Ubiquitous expression of wild-type transgenic atlastin is embryonic lethal, while eye-specific expression gives rise to a small eye phenotype, providing clear in vivo readouts for functional testing .

Each system has its advantages depending on the research question. Bacterial expression provides the highest protein yield for biochemical studies, while cellular and organismal systems allow for assessment of physiological relevance and in vivo function.

How can recombinant Atlastin be purified and reconstituted for in vitro membrane fusion assays?

The purification and reconstitution process for functional in vitro membrane fusion assays involves several critical steps:

  • Expression and purification:

    • Express Atlastin in E. coli

    • Purify using affinity chromatography (detailed purification protocols are not provided in the search results)

  • Reconstitution into liposomes:

    • Reconstitute purified Atlastin into synthetic phosphatidylcholine:phosphatidylserine (PCPS) liposomes

    • This creates proteoliposomes containing the recombinant protein

  • Membrane fusion assay setup:

    • Measure fusion by lipid mixing assays

    • Include appropriate controls such as GTP, GDP, or non-hydrolyzable GTP analogs (like GTPγS)

    • Monitor fusion rates in real-time

  • Functional validation:

    • Confirm GTPase activity of the reconstituted protein

    • Test membrane fusion activity

    • Verify that known requirements (like GTP hydrolysis) are maintained in the reconstituted system

Research has shown that GTP-dependent dimerization of atlastin generates an enzymatically active protein that drives membrane fusion after nucleotide hydrolysis and conformational reorganization . This provides a clear biochemical readout for functional validation of the reconstituted protein.

What is the mechanism of GTP-dependent oligomerization and how does it relate to membrane fusion activity?

Atlastin's GTP-dependent oligomerization and membrane fusion activity follow a sophisticated mechanism:

  • Nucleotide-dependent oligomerization:

    • Drosophila atlastin dimerizes in the presence of GTPγS but remains monomeric with GDP or without nucleotide

    • Oligomerization requires the juxtamembrane middle domain three-helix bundle (3HB)

  • Two-step mechanistic model:

    • GTP binding: Sufficient to promote atlastin self-assembly (tethering step)

    • GTP hydrolysis: Required for full fusion (fusion step)

  • Structural transitions:

    • GTP binding induces conformational changes that enable homodimerization

    • The 3HB middle domain mediates self-association

    • Packing of 3HBs from atlastin molecules on opposing membranes results in a trans-complex that tethers membranes

    • After GTP hydrolysis, a conformational reorganization occurs, bringing membranes close enough for fusion

  • Experimental evidence:

    • The R48A mutation (hydrolysis-specific mutant) retains GTP-binding ability and allows efficient complex formation but doesn't support membrane fusion

    • Addition of GTPγS potently inhibits an ongoing fusion reaction, confirming GTP hydrolysis is required for full fusion

This mechanistic insight reveals that atlastin functions through distinct and separable roles for GTP binding (tethering) and GTP hydrolysis (fusion), with the 3HB domain playing a critical role in both processes.

How do mutations in the three-helix bundle (3HB) domain affect Atlastin function at the molecular level?

Mutations in the three-helix bundle (3HB) domain have profound effects on Atlastin function through several critical mechanisms:

  • Disruption of protein oligomerization:

    • The 3HB domain is essential for atlastin oligomerization

    • Mutations of core hydrophobic residues within the 3HB prevent atlastin dimerization

  • Impact on GTPase activity:

    • The 3HB domain is required for efficient GTPase activity

    • Atlastin undergoes oligomerization-dependent stimulation of GTPase activity

    • Mutations of essential hydrophobic residues within the 3HB prevent this stimulatory effect

  • Molecular evidence from specific mutations:

    • Proline substitutions at positions 346 in helix α7, 374 in α8, and 396 and 404 in α9 of the 3HB have severely destabilizing effects on α-helix conformation

    • These mutations lead to loss of atlastin self-association properties and protein inactivation

    • In cellular assays, these mutants fail to induce the characteristic ER and Golgi morphology changes seen with wild-type atlastin

  • In vivo consequences:

    • The F404P mutation allows normal adult survival in Drosophila and has no phenotypic consequences in the eye, in contrast to wild-type atlastin expression which is embryonic lethal when expressed ubiquitously and causes a small eye phenotype when expressed in the eye

These findings demonstrate that the 3HB domain is a crucial structural component that integrates GTP binding, oligomerization, and the subsequent conformational changes required for membrane fusion.

How do disease-associated Atlastin mutations affect protein function in Drosophila models?

Disease-associated Atlastin mutations exhibit varying effects on protein function in Drosophila models, providing valuable insights into pathogenic mechanisms:

  • Categorization of mutations by functional impact:
    Four specific mutations have been extensively studied in Drosophila:

    • R192Q (corresponding to R217Q in human Atlastin-1): Completely defective in dimerization, GTPase and fusion activities

    • R214C (corresponding to R239C in human Atlastin-1): The most common pathological mutation, yet surprisingly indistinguishable from wild-type under in vitro experimental paradigms

    • C350R (corresponding to C375R in human Atlastin-1): Insoluble due to protein folding or stability issues

    • M383T (corresponding to M408T in human Atlastin-1): Shows slightly lower dimerization and GTPase activities compared to wild-type

  • Severity gradient in homozygous conditions:
    CRISPR/Cas9-edited Drosophila carrying these mutations show a gradient of phenotypic severity:

    • All mutations in homozygosity caused decreased adult eclosion rate and reduced size at all developmental stages

    • The severity increases in the succession: R214C < C350R < M383T < R192Q

    • R192Q homozygous individuals showed the lowest eclosion rate while R214C homozygous individuals eclosed at higher rates

  • Mechanistic insights:

    • All four pathological missense mutations act through a common loss-of-function mechanism but differ in the severity of phenotypes

    • No evidence was found supporting a dominant negative mechanism, as heterozygous individuals eclosed at normal rates and had normal size

    • Overexpression of the pathological variants in wild-type background did not give rise to the loss-of-function phenotypes expected for dominant negative mutations

These findings challenge the prevailing theory that most atlastin mutations act through a dominant negative mechanism, suggesting instead a spectrum of loss-of-function effects that correlate with disease severity.

What are the molecular and cellular consequences of Atlastin dysfunction in motor neurons?

Atlastin dysfunction in motor neurons leads to multiple molecular and cellular abnormalities that likely contribute to neurodegeneration:

  • Locomotor defects:

    • Atlastin knockdown specifically in motor neurons using UAS-dsRNA-Atlastin under the control of motor neuron-specific promoters (C380-Gal4 and OK6-GAL4) produces significant locomotor defects

    • These defects validate that neuronal-specific disruption of Atlastin is sufficient to cause motor abnormalities characteristic of HSP

  • Synaptic structure and function abnormalities:

    • Increased bouton number relative to muscle area in Atlastin-downregulated larvae

    • Increased satellite bouton number in both loss- and gain-of-function larvae

    • Impaired synaptic function and reduced vesicle density

  • Axonal trafficking defects:

    • Disruption of motor neuron Atlastin produces axonal trafficking disorganization

    • Abnormalities in the supply of presynaptic components

    • Altered integrity of spontaneous release and the reserve pool of synaptic vesicles

  • Endosomal and lysosomal abnormalities:

    • Accumulation of lysosomes and possibly degrading proteins within these structures

    • Evidence that clearance systems might be compromised in long axons

    • This represents a cellular hallmark of neurodegenerative diseases in Drosophila HSP models

  • Endosomal tubulation defects:

    • Neurons lacking atlastin have longer endosomal tubules, suggestive of defective tubule fission

    • This is accompanied by reduced lysosomal proteolytic capacity

These findings establish that neuronal Atlastin is required for normal locomotor behavior and synaptic function, with its loss leading to defects in axonal trafficking and organelle organization that may ultimately result in neurodegeneration.

How can researchers differentiate between direct Atlastin-dependent phenotypes and indirect effects due to altered BMP signaling?

Differentiating between direct Atlastin-dependent phenotypes and indirect effects due to altered BMP signaling requires sophisticated experimental designs:

  • Dual manipulation approach:

    • Simultaneously manipulate Atlastin and BMP pathway components to determine their relative contributions to observed phenotypes

    • Express Atlastin in a BMP signaling-deficient background to isolate Atlastin-specific effects

  • BMP pathway component analysis:

    • Assess levels of phosphorylated MAD (pMAD), the Drosophila homolog of SMAD, as a direct readout of BMP signaling

    • Analyze expression of BMP target genes such as trio

    • Compare these readouts between Atlastin knockdown/mutant conditions and controls

  • Genetic rescue experiments:

    • Test whether BMP pathway inhibition can rescue Atlastin loss-of-function phenotypes

    • Determine if Atlastin overexpression can rescue phenotypes caused by BMP pathway hyperactivation

  • Temporal manipulation:

    • Use temporally controlled expression systems (e.g., temperature-sensitive Gal80) to manipulate Atlastin expression at different developmental stages

    • Compare acute versus chronic effects to distinguish primary from secondary consequences

  • Specific synaptic vesicle trafficking analysis:

    • A study testing the hypothesis that Atl-dependent defects on synaptic vesicle traffic are direct consequences of atl-knockdown and not of Atl-dependent BMP signaling upregulation provides a methodological framework

    • This approach can help clarify which phenotypes are directly related to Atlastin's role in membrane trafficking versus indirect effects through BMP signaling

These methodological approaches allow researchers to dissect the complex relationship between Atlastin function and BMP signaling, which is crucial for understanding the pathogenic mechanisms of Atlastin-related HSP.

What techniques can be used to visualize and quantify Atlastin-mediated ER membrane fusion in vivo?

Visualizing and quantifying Atlastin-mediated ER membrane fusion in vivo requires sophisticated imaging and analytical techniques:

  • Fluorescent protein tagging approaches:

    • Express fluorescently tagged ER markers (e.g., Sec61β-GFP) to visualize ER morphology

    • Use photo-switchable or photo-activatable fluorescent proteins to track ER dynamics

    • Implement split-GFP complementation assays where fragments are expressed on different ER membranes to detect fusion events

  • High-resolution microscopy methods:

    • Super-resolution microscopy techniques such as STED or STORM to visualize ER network architecture beyond the diffraction limit

    • Live-cell imaging with spinning disk confocal microscopy to capture dynamic fusion events

    • Correlative light and electron microscopy (CLEM) to connect fluorescence data with ultrastructural information

  • Quantitative analysis parameters:

    • Measure ER three-way junction density as a direct readout of fusion activity

    • Assess tubular ER network complexity through branch point analysis

    • Quantify ER continuity using fluorescence recovery after photobleaching (FRAP)

  • In vivo experimental readouts:

    • In Drosophila, overexpression of wild-type Atlastin causes characteristic changes in ER morphology (formation of expanded ER) and redistribution of Golgi proteins to the ER

    • In mammalian cells, Atlastin overexpression creates "ER spots" due to excessive membrane fusion and Golgi dispersal

    • These phenotypes provide clear visual readouts for functional assessment

  • Quantifiable cellular assays:

    • In HeLa cells, the appearance of "spotty ER" and redistribution of Golgi markers serves as a quantifiable read-out for atlastin function

    • These phenotypes can be scored and quantified to compare wild-type and mutant proteins

These approaches enable researchers to directly visualize and quantitatively assess Atlastin's fusogenic activity in various cellular contexts, providing powerful tools for understanding both normal function and disease-related dysfunction.

What are the most effective approaches for studying the interaction between Atlastin and endosomal trafficking proteins?

Studying interactions between Atlastin and endosomal trafficking proteins requires multi-faceted approaches:

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation (Co-IP) to detect physical interactions between Atlastin and endosomal proteins

    • Proximity labeling methods (BioID, APEX) to identify proteins in close proximity to Atlastin in living cells

    • Yeast two-hybrid screening to identify direct binding partners

    • Interactome studies have already related Atlastin with Rab4, which is involved in rapid recycling of endocytosed components

  • Live-cell imaging techniques:

    • Dual-color live imaging of fluorescently tagged Atlastin and endosomal markers (Rab4, Rab7, Rab11)

    • FRET (Förster Resonance Energy Transfer) or FLIM (Fluorescence Lifetime Imaging) to detect direct interactions

    • Particle tracking to analyze movement and colocalization of Atlastin and endosomal proteins

  • Functional assays:

    • Assess endosomal tubulation in the presence and absence of Atlastin, as neurons lacking atlastin-1 have longer endosomal tubules

    • Measure endosomal trafficking rates using pulse-chase experiments with endocytic tracers

    • Quantify recycling efficiency of cargo proteins in Atlastin-deficient conditions

  • ER-endosome contact site analysis:

    • Visualize ER-endosome contact sites using split fluorescent protein approaches

    • Quantify contact site frequency, duration, and distribution in wild-type versus Atlastin-deficient neurons

    • The ER and its contact sites with endosomes confer the ER the role of a long-distance communicator

  • Combined genetic and pharmacological approaches:

    • Simultaneous manipulation of Atlastin and endosomal trafficking proteins (e.g., Rab GTPases)

    • Use of specific inhibitors of endosomal trafficking while monitoring Atlastin function

    • Expression of dominant-negative or constitutively active forms of trafficking regulators

These methodological approaches provide complementary data on both physical interactions and functional relationships between Atlastin and endosomal trafficking machinery, crucial for understanding Atlastin's role in coordinating ER structure with endosomal function.

What are common challenges in expressing and purifying functional recombinant Drosophila Atlastin, and how can they be addressed?

Researchers face several challenges when expressing and purifying functional recombinant Drosophila Atlastin:

  • Solubility issues:

    • Challenge: Some Atlastin variants (like C350R/C375R) are insoluble due to protein folding or stability issues

    • Solution:

      • Optimize expression conditions (temperature, induction time, media composition)

      • Include solubility-enhancing fusion tags (MBP, SUMO, thioredoxin)

      • Screen different detergents for membrane protein extraction

      • Consider co-expression with chaperones to aid proper folding

  • Maintaining native conformation:

    • Challenge: Ensuring the recombinant protein retains its proper folding and activity

    • Solution:

      • Verify GTPase activity as a functional readout

      • Confirm oligomerization properties in the presence of appropriate nucleotides

      • Use circular dichroism to assess secondary structure integrity, particularly for the critical 3HB region

  • Expression system selection:

    • Challenge: Different expression systems may affect protein functionality

    • Solution:

      • For biochemical studies: Use E. coli with optimization for membrane protein expression

      • For functional studies: Consider insect cell expression systems (Sf9, S2 cells) which may provide more native-like post-translational modifications

  • Reconstitution into membranes:

    • Challenge: Ensuring proper incorporation into liposomes for functional studies

    • Solution:

      • Optimize lipid composition to match Drosophila ER membranes

      • Control protein:lipid ratios to avoid aggregation or insufficient incorporation

      • Verify orientation in proteoliposomes through protease protection assays

  • Nucleotide-dependent conformational states:

    • Challenge: Capturing specific conformational states for structural or functional studies

    • Solution:

      • Use nucleotide analogs like GTPγS to stabilize specific conformations

      • Include transition state mimics for structural studies

      • Consider rapid kinetic approaches to capture transient states

By addressing these challenges methodically, researchers can improve the quality and functionality of recombinant Drosophila Atlastin preparations, enabling more reliable and reproducible experimental outcomes.

How can researchers validate that their recombinant Atlastin construct retains physiologically relevant activity?

Validating the physiological relevance of recombinant Atlastin constructs requires multi-level assessment:

  • Biochemical activity validation:

    • Measure GTPase activity and compare with published rates for wild-type protein

    • Confirm nucleotide-dependent oligomerization: Drosophila atlastin should dimerize in the presence of GTPγS but remain monomeric with GDP or without nucleotide

    • Verify that known motifs and domains (GTPase domain, 3HB, C-terminal tail) contribute to activity as expected

  • In vitro membrane fusion assays:

    • Reconstitute protein into liposomes and measure lipid mixing

    • Confirm GTP-dependence of fusion activity

    • Verify that fusion is blocked by non-hydrolyzable GTP analogs

    • Compare fusion rates with published values for wild-type protein

  • Cellular phenotype rescue:

    • Express construct in mammalian cells (e.g., HeLa or Cos7) and assess ER morphology

    • Wild-type Atlastin should cause formation of "ER spots" (enlarged ER) and Golgi dispersal

    • Test ability to rescue phenotypes in Atlastin-depleted cells

  • In vivo validation in Drosophila:

    • Express the construct in Atlastin-null Drosophila background

    • Assess rescue of developmental and behavioral phenotypes

    • Wild-type Atlastin expression should restore normal ER morphology, NMJ structure, and locomotor behavior

    • Ubiquitous expression of wild-type Atlastin is embryonic lethal, while eye-specific expression gives a small eye phenotype - these can serve as functional readouts

  • Structure-based validation:

    • For structural or mutational studies, confirm that the protein adopts expected conformational changes in response to nucleotides

    • Compare with published structural data for human atlastin orthologs

    • Verify that disease-associated mutations produce expected functional deficits

This multi-level validation strategy ensures that recombinant Atlastin constructs retain both biochemical activity and physiological relevance, crucial for translating in vitro findings to in vivo significance.

How might the study of Atlastin in Drosophila inform therapeutic approaches for Atlastin-related hereditary spastic paraplegia?

The study of Atlastin in Drosophila provides several promising avenues for therapeutic development:

  • Mutation-specific therapeutic strategies:

    • Different pathological mutations (R192Q, R214C, C350R, M383T) show varying severity in Drosophila models

    • This suggests potential for mutation-specific therapeutic approaches tailored to the molecular defect:

      • For GTPase-deficient mutations (R192Q): GTP analogs or allosteric activators

      • For structural mutations (C350R): Chemical chaperones or proteostasis modulators

      • For mild functional deficits (R214C): Augmenting residual function through overexpression strategies

  • Targeting downstream pathways:

    • Lysosomal dysfunction appears to be a consequence of Atlastin loss:

      • Neurons lacking atlastin-1 show reduced lysosomal proteolytic capacity

      • Accumulation of lysosomes is observed in Drosophila models

    • Therapeutic approaches enhancing lysosomal function (e.g., TFEB activators) might ameliorate disease phenotypes

  • Synaptic vesicle mobilization pathways:

    • Atlastin regulates synaptic vesicle mobilization in Drosophila

    • Therapeutics enhancing vesicle mobilization or neurotransmitter release might compensate for Atlastin dysfunction

    • This could include modulators of endosomal trafficking proteins like Rab4, which interacts with Atlastin

  • BMP signaling modulation:

    • Atlastin downregulates BMP signaling in Drosophila

    • Targeted inhibition of BMP pathway components might counteract the effects of Atlastin loss

    • This approach could specifically address the trans-synaptic signaling defects

  • Membrane fusion enhancement:

    • Direct enhancement of ER membrane fusion through other mechanisms might bypass Atlastin deficiency

    • Identification of alternative fusogenic proteins or small molecules that promote ER network formation

  • Gene therapy approaches:

    • Drosophila studies provide valuable information on which Atlastin regions and functions are most critical

    • This informs the design of gene therapy constructs that might deliver functional Atlastin to affected neurons

    • The single atlastin gene in Drosophila simplifies therapeutic testing compared to mammals with three ATL genes

These potential therapeutic directions, informed by Drosophila studies, offer promising approaches for treating Atlastin-related HSP by addressing specific molecular mechanisms of disease.

What novel techniques could advance our understanding of the temporal dynamics of Atlastin-mediated membrane fusion?

Advancing our understanding of Atlastin's temporal dynamics requires cutting-edge methodological approaches:

  • Single-molecule imaging techniques:

    • Single-molecule FRET to observe conformational changes in real-time

    • Total internal reflection fluorescence (TIRF) microscopy to visualize individual fusion events at supported membranes

    • These approaches could resolve the sequence of events from GTP binding through oligomerization to membrane fusion

  • Optogenetic control of Atlastin activity:

    • Development of light-sensitive Atlastin variants (e.g., fusion with photoswitchable domains)

    • This would enable precise temporal control of Atlastin activation to study fusion dynamics

    • Combined with live imaging, this approach could reveal the kinetics of membrane reorganization

  • Cryo-electron tomography (cryo-ET):

    • Direct visualization of Atlastin-mediated membrane fusion intermediates in a near-native state

    • This could reveal the structural rearrangements during the fusion process

    • Combined with correlative light microscopy, specific fusion events could be targeted for imaging

  • Advanced fluorescence microscopy techniques:

    • FLIM-FRET (Fluorescence Lifetime Imaging Microscopy-FRET) to detect conformational changes and protein interactions with high temporal resolution

    • Super-resolution microscopy (STED, PALM, STORM) to visualize ER remodeling beyond the diffraction limit

    • Light-sheet microscopy for rapid 3D imaging of ER networks in living cells

  • Time-resolved structural methods:

    • Time-resolved X-ray crystallography or cryo-EM to capture structural transitions during the GTPase cycle

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to detect conformational changes in solution

    • These approaches could link specific structural states to functional outcomes

  • Computational approaches:

    • Molecular dynamics simulations to model membrane deformation and fusion

    • These could be informed by experimental data to provide insights into energetics and kinetics

    • Machine learning approaches to analyze complex dynamic behaviors in large imaging datasets

These novel techniques would provide unprecedented insights into the temporal dynamics of Atlastin-mediated membrane fusion, potentially revealing new intervention points for therapeutic development.

How does Drosophila Atlastin function compare with its mammalian orthologs in terms of cellular roles and disease implications?

Comparing Drosophila Atlastin with mammalian orthologs reveals important similarities and differences:

FeatureDrosophila AtlastinMammalian AtlastinsImplications
Gene complexitySingle atl gene Three genes (ATL1-3) Drosophila provides a simplified model without functional redundancy
Expression patternBroadly expressedTissue-specific expression: ATL1 (predominantly neuronal), ATL2/3 (broader distribution) Mammalian system allows study of tissue-specific effects
Structural conservation541 aa protein with GTPase domain, 3HB, TM domains, and C-terminal tail Highly conserved domain structure, 44-49% identical (61-68% similar) to human isoforms Structural studies in Drosophila likely relevant to human proteins
ER morphology regulationRequired for ER tubule fusion and network formation Same function in mammals, with additional roles in ER-Golgi interactions Core membrane fusion function conserved across species
Synaptic functionRegulates synaptic vesicle mobilization and distribution Similar role in mammals, with additional roles in axon development Synaptic roles relevant to disease pathogenesis conserved
Signaling pathway interactionDownregulates BMP signaling Interacts with multiple signaling pathways including BMPSome signaling interactions conserved across species
Disease mechanismsLoss-of-function in Drosophila models Both loss-of-function and dominant-negative mechanisms proposed in mammals Drosophila models may not capture all disease mechanisms
Endolysosomal systemAffects endosomal tubulation and trafficking Similar defects observed in mammalian models, with reduced lysosomal proteolytic capacity Endolysosomal dysfunction is a conserved consequence of Atlastin deficiency

Key insights from this comparison:

  • The core molecular functions of Atlastin in ER membrane fusion and network formation are highly conserved from Drosophila to mammals.

  • The single Drosophila atl gene provides a simplified system for studying functions that might be distributed among three genes in mammals.

  • Both Drosophila and mammalian Atlastins affect the endolysosomal system, suggesting a conserved role in coordinating ER function with endosomal trafficking.

  • The pathogenic mechanisms uncovered in Drosophila models (particularly affecting synaptic function and axonal trafficking) are likely relevant to human disease.

  • Some differences in disease mechanisms exist, with conflicting evidence regarding dominant-negative effects that are observed in some mammalian studies but not supported by Drosophila models .

This comparative analysis highlights the value of Drosophila as a model system while acknowledging the additional complexity of mammalian Atlastin biology that must be considered when translating findings to human disease contexts.

What insights can be gained from studying the interaction between Atlastin and different lipid compositions?

Studying Atlastin's interaction with different lipid compositions provides critical insights into its function and regulation:

  • Membrane fusion efficiency determinants:

    • Lipid composition likely affects Atlastin's membrane fusion activity

    • In reconstitution studies, Atlastin has been successfully incorporated into synthetic phosphatidylcholine:phosphatidylserine (PCPS) liposomes

    • Systematic studies with varying lipid compositions could reveal optimal conditions for fusion

    • This could include testing contributions of:

      • Membrane curvature-inducing lipids (e.g., phosphatidylethanolamine)

      • Charged lipids (e.g., phosphatidylserine, phosphatidylinositol phosphates)

      • Cholesterol and other sterols

  • Lipid microdomains and protein clustering:

    • Lipid rafts or ordered membrane domains might affect Atlastin clustering

    • This could potentially regulate the efficiency of GTP-dependent oligomerization

    • The transmembrane domains of Atlastin likely have specific lipid preferences that could be mapped

  • ER-specific lipid requirements:

    • The ER has a distinct lipid composition compared to other cellular membranes

    • Determining how this specific composition affects Atlastin function could reveal why Atlastin activity is restricted to the ER

    • This could include roles of:

      • Low cholesterol content of the ER

      • High phosphatidylcholine content

      • Specific phosphoinositide species

  • Lipid transfer at membrane contact sites:

    • Atlastin is located at ER-endosome contact sites which are important for lipid transfer

    • Studies could explore whether Atlastin directly facilitates lipid transfer between membranes

    • This would connect Atlastin's role in membrane structure with its effects on endosomal function

  • Disease-relevant lipid interactions:

    • HSP-associated mutations might alter Atlastin's interaction with specific lipids

    • This could represent an unexplored disease mechanism

    • Therapeutic approaches targeting lipid composition or metabolism might modulate Atlastin function

Methodological approaches for these studies could include:

  • Liposome-based fusion assays with defined lipid compositions

  • GUV (giant unilamellar vesicle) systems for visualizing membrane dynamics

  • Native mass spectrometry to detect specific lipid-protein interactions

  • Molecular dynamics simulations to model lipid-protein interactions

These studies would provide a more complete understanding of how Atlastin function is regulated in its native membrane environment and potentially reveal new approaches for therapeutic intervention.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.