Recombinant Drosophila melanogaster ATP synthase subunit a (mt:ATPase6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it accordingly.
Synonyms
mt:ATPase6; ATP6; ATPase6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
mt:ATPase6
Target Protein Sequence
MMTNLFSVFDPLAIFNFSLNWLSTFLGLLMIPSIYWLMPSRYNIMWNSILLTLHKEFKTL LGPSGHNGSTFIFISLFSLILFNNFMGLFPYIFTSTSHLTLTLSLALPLWLCFMLYGWIN HTQHMFAHLVPQGTPAILMPFMVCIETISNIIRPGTLAVRLTANMIAGHLLLTLLGNTGS SMSYMLMTFLLMAQIALLVLESAVAMIQSYVFAVLSTLYSSEVN
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for generating ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. Subunit a is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Database Links

KEGG: dme:ATP6

STRING: 7227.FBpp0100179

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the role of ATP synthase subunit a (mt:ATPase6) in Drosophila mitochondria?

ATP synthase subunit a, encoded by the mt:ATPase6 gene, forms a critical component of mitochondrial ATP synthase (Complex V). This subunit is embedded in the mitochondrial inner membrane as part of the FO domain and plays an essential role in proton translocation. Specifically, it forms a channel that allows positively charged protons to flow across the specialized inner mitochondrial membrane. This proton flow generates the energy necessary for the F1 domain to catalyze the conversion of adenosine diphosphate (ADP) to adenosine triphosphate (ATP), which is the cell's main energy source .

The mt:ATPase6 protein functions within the larger ATP synthase complex, which in mammals consists of at least 16 different subunits organized into two major functional domains (F1 and FO) connected by two stalks . The precise arrangement allows the enzyme to couple the proton gradient created by the electron transport chain to the synthesis of ATP through oxidative phosphorylation.

How is the mt:ATPase6 gene organized in Drosophila compared to humans?

In Drosophila melanogaster, similar to humans, the mt:ATPase6 gene is encoded by the mitochondrial genome rather than the nuclear genome. While the search results don't provide specific details about the organization of mt:ATPase6 in Drosophila, we know that in mammals, mt:ATPase6 and mt:ATPase8 (encoding subunit A6L) are both encoded by the mitochondrial genome .

The mitochondrial genetic code differs slightly from the nuclear genetic code, which has implications for research involving recombinant expression . When attempting allotopic expression (expressing mitochondrially-encoded genes in the nucleus), researchers must consider these genetic code differences. For example, some codons may need to be modified to ensure proper translation when the gene is expressed from the nucleus rather than within the mitochondria .

What technical challenges exist when working with recombinant mt:ATPase6 from Drosophila?

Working with recombinant mt:ATPase6 presents several significant challenges:

  • Mitochondrial genome manipulation: Direct manipulation of the mitochondrial genome is extremely difficult, which makes traditional gene editing approaches challenging .

  • Codon optimization: The mitochondrial genetic code differs from the nuclear code, necessitating codon optimization when expressing mitochondrial genes from the nucleus .

  • Protein import: Successfully importing nucleus-encoded mitochondrial proteins back into the mitochondria requires specific targeting sequences and may face efficiency limitations .

  • Hydrophobicity: The mt:ATPase6 protein is highly hydrophobic, making it difficult to work with using standard protein purification techniques.

  • Complex assembly: Proper integration into the multi-subunit ATP synthase complex is required for function, complicating functional studies of the isolated protein.

Researchers have explored various strategies to overcome these challenges, including:

  • Using different mitochondrial targeting sequences (MTSs)

  • Attaching specific 3' untranslated regions (UTRs) such as SOD2 or OXA1 to mRNA

  • Employing suboptimally-encoded codons

  • Using translational inhibitors (TLIs)

What Drosophila models are available for studying mt:ATPase6 function and dysfunction?

Several Drosophila models have been developed to study ATP synthase and specifically mt:ATPase6:

These models provide complementary approaches to understanding ATP synthase function and dysfunction, with phenotypes that can be categorized into three broad pathological consequences:

Pathological CategoryPrimary PhenotypesExamples
Pre-adult lethalityDevelopmental arrest, larval deathSevere ATPsynC mutations
Multi-trait pathology with early adult lethalityDevelopmental delay, reduced lifespan, sterilityIntermediate ATPsynC mutations
Multi-trait adult pathologyBehavioral defects, reduced fertility, locomotor issuesMild ATPsynC mutations , ATP6 missense mutations

How do mutations in mt:ATPase6 contribute to disease phenotypes in model organisms?

Mutations in mt:ATPase6 lead to disease phenotypes through several mechanisms:

  • Impaired ATP production: The primary consequence is reduced ATP synthesis, leading to energy deficiency in cells with high energy demands (brain, muscles, heart) .

  • Mitochondrial morphology alterations: ATP synthase mutations affect mitochondrial cristae formation, potentially disrupting the entire respiratory chain organization .

  • Cellular stress responses: Energy deficiency triggers various stress response pathways, potentially including increased ROS production and altered mitochondrial dynamics.

In Drosophila models with ATP6 mutations, researchers have observed phenotypes similar to human mitochondrial diseases, including:

  • Reduced longevity

  • Locomotor dysfunction (measured by recovery time after mechanical stress)

  • Developmental delays

  • Neurological abnormalities

The severity of these phenotypes correlates with the degree of ATP synthase dysfunction, creating a spectrum of disease manifestations from mild to lethal.

What relationship exists between mt:ATPase6 mutations and Leigh syndrome?

Mutations in mt:ATPase6 account for approximately 10% of Leigh syndrome cases, making it a significant genetic cause of this progressive brain disorder . Leigh syndrome typically appears in infancy or early childhood and presents with:

  • Delayed development

  • Muscle weakness

  • Problems with movement

  • Difficulty breathing

The most common mt:ATPase6 mutation associated with Leigh syndrome is T8993G, which replaces the nucleotide thymine with guanine at position 8993 . This and other mutations impair the function or stability of the ATP synthase complex, inhibiting ATP production and disrupting oxidative phosphorylation.

The mechanism by which ATP synthase dysfunction leads to neurodegeneration likely involves energy deficiency in highly metabolically active tissues. Brain tissues have particularly high energy demands and appear especially sensitive to disruptions in oxidative phosphorylation, potentially explaining the predominant neurological manifestations of these disorders .

What gene therapy strategies show promise for treating mt:ATPase6 mutations?

Allotopic expression represents the primary gene therapy approach being explored for mt:ATPase6 mutations. This strategy involves:

  • Nuclear expression of mitochondrial genes: Expressing the mitochondrially-encoded ATP6 gene from the nuclear genome .

  • Mitochondrial targeting: Engineering the protein with mitochondrial targeting sequences to direct import into mitochondria .

  • Functional integration: Ensuring the imported protein correctly integrates into the ATP synthase complex.

Results from allotopic rescue experiments have been mixed:

  • Some in vitro studies show restoration of ATP synthase activity

  • Others show limited or no rescue effects

A particularly promising approach involves using ATP6 protein from the algae Chlamydomonas reinhardtii. Research using Drosophila models with endogenous ATP6 mutations has shown that algal ATP6 provides more effective rescue than other approaches . This may be due to differences in hydrophobicity or other properties that facilitate mitochondrial import and integration.

Additional strategies being explored include:

  • Using different mitochondrial targeting sequences (MTSs)

  • Attaching specific 3' untranslated regions (3'UTRs) to mRNA

  • Utilizing suboptimally-encoded codons

  • Employing translational inhibitors (TLIs)

  • Overexpressing factors involved in mitochondrial biogenesis (AMPK, PGC1-α, DSP1)

  • Enhancing mitophagy (ATG1) or mitochondrial protein folding/degradation (mtHSP70)

How can researchers effectively measure ATP synthase activity in Drosophila models?

Measuring ATP synthase activity in Drosophila models can be accomplished through several complementary approaches:

  • ATPase activity assay:

    • Prepare mitochondrial protein-enriched extracts from embryos (typically 0-3 hour collections)

    • Measure ATPase activity in parallel samples with and without sodium azide (a specific inhibitor of mitochondrial ATP synthase)

    • The difference represents the mitochondrial ATP synthase-specific activity

  • ATP synthesis rate measurement:

    • Isolate intact mitochondria from Drosophila tissues

    • Provide substrates and ADP

    • Measure ATP production over time using luminescence-based assays

  • Functional readouts in vivo:

    • Measure longevity of flies with ATP synthase mutations

    • Assess locomotor function (e.g., recovery time after mechanical stress test)

    • Evaluate developmental timing and success rates

  • Blue Native-PAGE analysis:

    • Separate intact ATP synthase complexes

    • Assess assembly status and quantity of complete complex V

A comprehensive approach would combine these methods to provide both direct biochemical measurements and physiological outcomes.

What is the relationship between ATP synthase subunit acetylation and enzyme activity?

ATP synthase activity is regulated by post-translational modifications, including acetylation. Research has shown that:

  • ATP synthase β (the catalytic subunit of mitochondrial complex V) is deacetylated by sirtuin 3 in humans and its Drosophila homologue, dSirt2 .

  • In dsirt2 mutant flies, specific lysine residues in ATP synthase β show increased acetylation, correlating with decreased complex V activity .

  • Overexpression of dSirt2 increases complex V activity, demonstrating a causal relationship .

Specific acetylation sites have significant functional impacts:

  • Substitution of Lys 259 and Lys 480 with Arg in human ATP synthase β (mimicking deacetylation) increases complex V activity

  • Substitution with Gln (mimicking acetylation) decreases activity

This regulation appears to be part of a broader metabolic control network. Researchers have identified a ceramide–NAD+–sirtuin axis wherein increased ceramide (a sphingolipid known to induce stress responses) results in depletion of NAD+ and consequent decrease in sirtuin activity, leading to hyperacetylation of ATP synthase and reduced activity .

What strategies exist for generating recombinant mt:ATPase6 protein for structural studies?

Generating recombinant mt:ATPase6 protein presents significant challenges due to its hydrophobic nature and mitochondrial origin. Several approaches have been developed:

  • Heterologous expression systems:

    • Bacterial expression with fusion tags to enhance solubility

    • Yeast expression systems that can properly process mitochondrial proteins

    • Cell-free systems for membrane protein synthesis

  • Codon optimization strategies:

    • Adapt the mitochondrial genetic code for nuclear expression

    • Consider using suboptimally-encoded codons to slow translation and improve folding

  • Purification approaches:

    • Detergent solubilization methods optimized for highly hydrophobic proteins

    • Affinity chromatography with carefully positioned tags to avoid interfering with function

    • Native purification of entire ATP synthase complex followed by subunit isolation

One innovative approach involves expressing the algal ATP6 protein (from Chlamydomonas reinhardtii) which has shown better functional outcomes in rescue experiments than mammalian versions, suggesting it may have properties that make it more amenable to recombinant expression and functional studies .

How can researchers differentiate between primary and secondary effects of mt:ATPase6 mutations?

Differentiating primary from secondary effects of mt:ATPase6 mutations requires a multi-faceted experimental approach:

  • Temporal analysis:

    • Study the progression of phenotypes over time

    • Identify the earliest detectable abnormalities

    • In Drosophila sun mutants (affecting ATP synthase ε-subunit), defects appear specifically after nuclei migrate to the cortex, suggesting this is when energy demands first exceed compromised capacity

  • Tissue-specific analysis:

    • Compare effects across tissues with different energy demands

    • Use tissue-specific expression systems to rescue phenotypes

    • Determine if certain tissues are more vulnerable to ATP synthase dysfunction

  • Biochemical hierarchy:

    • Measure multiple parameters (ATP levels, mitochondrial membrane potential, ROS production)

    • Establish the sequence of biochemical changes

    • Correlate with the appearance of phenotypic abnormalities

  • Rescue experiments:

    • Test whether ATP supplementation can rescue phenotypes

    • Compare with specific restoration of ATP synthase function

    • In sun mutants, the most striking abnormality is that nuclei and spindles form lines and clusters instead of adopting regular spacing, suggesting selective effects on molecular motors dependent on ATP

  • Genetic interaction studies:

    • Cross ATP synthase mutants with strains carrying mutations in other pathways

    • Identify suppressors and enhancers

    • The ATPsynC mutations provide "a powerful toolkit for the screening of genetic modifiers that can lead to potential therapeutic solutions"

What experimental approaches are most effective for studying the assembly of ATP synthase complex incorporating recombinant mt:ATPase6?

Studying ATP synthase assembly with recombinant mt:ATPase6 requires specialized techniques:

  • Blue Native-PAGE analysis:

    • Gentle detergent solubilization preserves protein complexes

    • Size-based separation reveals assembly intermediates

    • Western blotting with subunit-specific antibodies identifies composition

    • Comparison between wild-type and mutant samples reveals assembly defects

  • Pulse-chase experiments:

    • Label newly synthesized proteins

    • Track incorporation into ATP synthase complex over time

    • Compare assembly kinetics between wild-type and mutant proteins

  • Import assays using isolated mitochondria:

    • In vitro synthesize recombinant mt:ATPase6 with various targeting sequences

    • Incubate with isolated mitochondria

    • Measure import efficiency and subsequent assembly

    • Test different conditions to optimize incorporation

  • Cryo-electron microscopy:

    • Visualize ATP synthase structure at near-atomic resolution

    • Compare complexes with wild-type versus recombinant mt:ATPase6

    • Identify structural changes or assembly abnormalities

  • Proteomic analysis of assembly factors:

    • Identify proteins that interact with mt:ATPase6 during assembly

    • Compare interactome between wild-type and recombinant versions

    • The assembly of ATP synthase complex "requires the assistance of several chaperones, in a process still not completely understood at the molecular level"

What are the current limitations in creating site-directed mutations in mt:ATPase6 and how can they be overcome?

Creating site-directed mutations in mt:ATPase6 is challenging due to the difficulty of manipulating the mitochondrial genome. Current limitations and potential solutions include:

  • Limited mitochondrial genome editing tools:

    • Challenge: Direct manipulation of mtDNA is extremely difficult

    • Solution: Allotopic expression of modified genes from the nucleus with mitochondrial targeting

  • Heteroplasmy complications:

    • Challenge: Cells contain multiple mitochondria with mixed populations of mtDNA

    • Solution: Selection strategies to enrich for mitochondria containing the desired mutation

  • Import efficiency barriers:

    • Challenge: Nuclear-encoded versions of mitochondrial proteins often import poorly

    • Solution: Test various mitochondrial targeting sequences and optimize protein properties

    • The algal ATP6 protein has shown better rescue results, suggesting better import properties

  • Integration into complex:

    • Challenge: Imported proteins may not properly integrate into ATP synthase

    • Solution: Engineer versions with enhanced assembly capabilities

  • Model system limitations:

    • Challenge: Findings in Drosophila may not translate directly to humans

    • Solution: Validate key findings in mammalian cell models

Recent advances show promise, particularly the use of Drosophila models with endogenous ATP6 mutations which provide a stable platform for testing different allotopic expression strategies . Combining these models with emerging mitochondrial genome editing technologies may eventually overcome current limitations.

How might knowledge of Drosophila mt:ATPase6 structure and function inform therapeutic approaches for human mitochondrial diseases?

The high evolutionary conservation of ATP synthase makes Drosophila an excellent model for understanding human mitochondrial diseases. Future therapeutic development may benefit from Drosophila studies in several ways:

  • Identification of functional domains:

    • Mapping mutations to specific protein regions

    • Correlating structural changes with functional outcomes

    • Developing targeted interventions for specific mutation types

  • Drug screening platforms:

    • Drosophila models provide an efficient system for screening compounds

    • "ATPsynC mutations...represent a powerful toolkit for the screening of genetic modifiers that can lead to potential therapeutic solutions"

    • Compounds effective in flies can be prioritized for mammalian testing

  • Gene therapy optimization:

    • Testing different versions of allotopic expression

    • Identifying the most effective targeting sequences and mRNA modifications

    • Algal ATP6 has shown superior rescue effects, suggesting biomimetic approaches may be valuable

  • Pathological mechanism insights:

    • Understanding the three broad categories of ATP synthase dysfunction in Drosophila

    • Correlating with human disease manifestations

    • Developing stage-specific interventions

  • Compensatory pathway identification:

    • Discovering genetic modifiers that suppress disease phenotypes

    • Identifying metabolic adaptations that allow some tissues to better tolerate ATP synthase dysfunction

    • Developing interventions that enhance these protective mechanisms

What is the relationship between mt:ATPase6 function and other mitochondrial processes such as mitophagy and mitochondrial dynamics?

The relationship between ATP synthase function and broader mitochondrial processes represents an important frontier in research:

  • Mitochondrial quality control:

    • ATP synthase dysfunction may trigger mitophagy to eliminate damaged mitochondria

    • Research suggests overexpressing factors involved in mitophagy (ATG1) may help manage ATP synthase defects

  • Mitochondrial dynamics:

    • ATP synthase plays a role in cristae formation and inner membrane structure

    • Mutations likely affect fusion/fission balance and network organization

    • These structural changes may exacerbate energy production deficits

  • Mitochondrial protein homeostasis:

    • Proper folding and degradation of mitochondrial proteins becomes critical when ATP synthase is compromised

    • Overexpression of mitochondrial chaperones like mtHSP70 represents a potential intervention strategy

  • Retrograde signaling:

    • ATP synthase dysfunction triggers nuclear responses

    • Understanding these signaling pathways may reveal therapeutic targets

    • Factors involved in mitochondrial biogenesis (AMPK, PGC1-α, DSP1) show promise as intervention points

  • Metabolic reprogramming:

    • Cells with ATP synthase dysfunction must adapt metabolically

    • Identifying these adaptations may suggest therapeutic approaches

    • The "ceramide–NAD+–sirtuin axis" represents one such metabolic control network affected by mitochondrial stress

Future research in this area will likely reveal complex interactions between ATP synthase function and broader cellular processes, potentially identifying new therapeutic targets beyond the primary defect.

How does the expression and activity of recombinant mt:ATPase6 vary across different tissues and developmental stages in Drosophila?

Understanding tissue-specific and developmental regulation of ATP synthase represents an important research direction:

  • Developmental expression patterns:

    • ATP synthase requirements change throughout development

    • In stunted (sun) mutants affecting ATP synthase ε-subunit, defects appear specifically after nuclei migrate to the cortex

    • The timing suggests differential sensitivity to ATP limitations across developmental stages

  • Tissue-specific energy demands:

    • ATP synthase expression and activity vary across tissues

    • Neurons, muscles, and cardiac tissue are particularly sensitive to dysfunction

    • Understanding these differences may explain disease tissue specificity

  • Compensatory mechanisms:

    • Some tissues may better adapt to ATP synthase deficiencies

    • Identifying these adaptations could inform therapeutic approaches

    • Comparative analysis across tissues could reveal protective factors

  • Sex-specific differences:

    • ATP synthase mutations can affect males and females differently

    • Some mutations cause "aberrant male courtship behavior"

    • Hormonal influences on mitochondrial function represent an underexplored area

  • Maternal contribution:

    • Early embryonic development relies on maternally-deposited components

    • The maternal-effect phenotypes of ATP synthase mutations (as seen in sun mutants) highlight the importance of understanding this contribution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.