Recombinant Drosophila melanogaster Congested-like trachea protein (colt)

Shipped with Ice Packs
In Stock

Description

Genetic and Molecular Background

The colt gene (CG3057) is located at cytological position 23A on the Drosophila polytene chromosomes. It encodes a 306-amino-acid protein with three tandem repeats, each containing two transmembrane segments and a loop domain . COLT shares homology with mitochondrial carrier proteins, particularly the Caenorhabditis elegans DIF-1 protein, which is involved in embryonic differentiation .

Key features of the colt gene:

  • Structure: Single exon, producing a 1.4-kb transcript .

  • Function: Required for tracheal gas-filling during embryogenesis and wing morphogenesis .

  • Mutation effects: P-element insertions cause semi-lethality, collapsed tracheae, and reduced wing size .

Recombinant COLT Protein Characteristics

Recombinant COLT is produced using expression systems like E. coli or insect cells, enabling biochemical and functional studies. Commercial preparations (e.g., GeneBioSystems) provide high-purity protein for research .

ParameterDetails
UniProt IDQ9VQG4
Expression HostE. coli
TagHis-tag (position determined during production)
Amino Acid Sequence1-306 (Full-length mature protein)
Purity>90% (SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 50% glycerol
SequenceMTTTENVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGT... (306 aa)

Functional Role in Drosophila

  • Tracheal development: Zygotic COLT is essential for gas-filling of tracheal tubes post-hatching. Mutants exhibit collapsed tracheae, leading to larval lethality .

  • Mitochondrial carrier activity: COLT belongs to the SLC25 mitochondrial carrier family, facilitating metabolite transport across the mitochondrial inner membrane .

  • Wing morphogenesis: colt mutants display defective wing expansion and venation, linking mitochondrial function to epithelial remodeling .

Recombinant Production and Applications

Production workflow:

  1. Gene insertion: Stable integration of the colt coding sequence into expression vectors.

  2. Inducible expression: Temperature-sensitive promoters optimize protein yield while minimizing metabolic stress .

  3. Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged proteins) followed by buffer exchange .

Research applications:

  • Mechanistic studies: Investigating mitochondrial transport kinetics and tracheal system development .

  • Disease modeling: Analysing mitochondrial dysfunction in human homologs (e.g., SLC25A46-linked pathologies) .

  • Protein interaction screens: Identifying binding partners using recombinant COLT as bait .

Comparative Insights from Mitochondrial Carrier Family

Drosophila has 48 putative mitochondrial carrier genes, but only 20 are characterized. COLT’s closest human homologs include:

Drosophila ProteinHuman HomologIdentityFunction
COLT (CG3057)SLC25A46~50%Lipid transport, mitochondrial dynamics
DmCIC (CG6782)SLC25A165%Tricarboxylate transport

COLT’s testis-biased expression in Drosophila suggests a role in germline mitochondrial metabolism .

Challenges and Future Directions

  • Low expression yield: Recombinant COLT production in mammalian cells yields ~50-fold less protein than bovine rhodopsin , necessitating optimized expression systems.

  • Functional redundancy: Duplicated mitochondrial carrier genes in Drosophila complicate loss-of-function studies .

  • Therapeutic potential: Structural studies of COLT could inform drug design for mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
colt; CG3057; Congested-like trachea protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
colt
Target Protein Sequence
MTTTENVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGT FDCAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFV AGSFSGLFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCA TMLRDLPANGLYFLVYEALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKS RLQSAPEGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANKFFN IVAPNF
Uniprot No.

Target Background

Function
Putative mitochondrial carrier of unknown solute specificity. It is required for gas-filling of the tracheal system during embryonic hatching and for normal epithelial morphogenesis of the wings.
Database Links

KEGG: dme:Dmel_CG3057

STRING: 7227.FBpp0077414

UniGene: Dm.19772

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the congested-like trachea (colt) protein in Drosophila melanogaster?

The congested-like trachea (colt) protein in Drosophila melanogaster is involved in tracheal development and function. As a model organism, Drosophila offers significant advantages for studying proteins like colt due to its fully sequenced genome and the extensive genetic tools available. The fruit fly's rapid life cycle of 10-14 days and high reproductive rate make it particularly valuable for protein function studies . Researchers can effectively investigate colt protein using the genetic tractability of Drosophila, which allows for controlled genetic manipulation to understand its role in developmental processes.

What genetic approaches can be used to study colt function in Drosophila?

Several genetic approaches can be employed to study colt function:

  • Forward Genetic Screens: Generate random mutations and screen for tracheal development phenotypes. This approach can identify alleles affecting colt function without prior assumptions about its role .

  • Reverse Genetics: Use techniques like P-element insertion or CRISPR-Cas9 to specifically disrupt the colt gene .

  • Gal4-UAS System: This Drosophila-specific tool allows tissue-specific expression or knockdown of colt to examine its function in different developmental contexts .

  • Mosaic Analysis: Create genetic mosaics to study colt function in specific cells or tissues against a wild-type background .

The powerful genetic toolkit available for Drosophila makes it possible to dissect the functional role of colt through multiple complementary approaches, which would be more challenging in other model systems .

How is Drosophila melanogaster maintained for colt protein research?

Maintaining consistent Drosophila stocks for colt protein research requires careful attention to environmental conditions:

ParameterRecommended ConditionNotes
Temperature25°C (±1°C)Lower temperatures slow development
Humidity60-70%Prevents desiccation of medium
Light cycle12hr light/12hr darkMaintains circadian rhythm
Population density50-100 flies per vialPrevents overcrowding effects
Medium replacementEvery 14-21 daysPrevents mold contamination

To ensure experimental reproducibility, researchers should maintain multiple replicate populations with effective population sizes of at least 1,000 individuals, which helps retain genetic variation and mitigate genetic drift effects during experiments . Regular screening for phenotypes of interest and consistent handling procedures help maintain genetic stability across generations, which is critical for long-term studies of proteins like colt .

What expression systems are optimal for producing recombinant Drosophila colt protein?

For recombinant expression of Drosophila colt protein, several systems can be employed with varying advantages:

  • Bacterial Expression (E. coli):

    • Advantages: Rapid growth, high yield, cost-effective

    • Limitations: May lack proper post-translational modifications essential for colt function

    • Optimization: Use strain BL21(DE3) with codon optimization for Drosophila genes

  • Insect Cell Expression (Sf9, S2 cells):

    • Advantages: Native-like post-translational modifications, proper protein folding

    • Protocol modifications: For S2 cells, use copper-inducible metallothionein promoter for controlled expression

    • Co-expression with chaperones may increase proper folding of colt protein

  • Drosophila in vivo expression:

    • Using the GAL4-UAS system for tissue-specific expression in live flies

    • Enables study of colt in its native context with proper regulation

When selecting an expression system, consider that the complex structure and potential post-translational modifications of colt protein may necessitate eukaryotic expression systems for functional studies. For structural studies, bacterial expression with subsequent refolding protocols might be sufficient .

How can I design genetic screens to identify interactors of colt protein?

Designing effective genetic screens to identify colt protein interactors requires careful consideration of several experimental approaches:

  • Enhancer/Suppressor Screens:

    • Create flies with mild colt gain-of-function or loss-of-function phenotypes

    • Screen for mutations that enhance or suppress these phenotypes

    • This approach can identify genes that functionally interact with colt in vivo

  • Yeast Two-Hybrid Screens:

    • Construct a bait plasmid containing the colt coding sequence

    • Screen against a Drosophila cDNA library

    • Verify interactions using co-immunoprecipitation in Drosophila S2 cells

  • Proteomics Approaches:

    • Express tagged colt protein in Drosophila tissues

    • Perform immunoprecipitation followed by mass spectrometry

    • Compare results from different developmental stages to identify stage-specific interactors

A particularly powerful approach combines direct selection in replicated populations with genomic analysis. Create replicated populations with colt mutations and control populations, then compare allele frequencies at various loci to identify associations between phenotypic and genetic changes that may represent interacting partners .

What are the best methods for purifying recombinant colt protein from Drosophila?

Purification of recombinant colt protein from Drosophila requires a systematic approach:

Purification StepMethodCritical Parameters
Initial ExtractionTissue homogenization in buffer with protease inhibitorspH 7.4-8.0, 4°C temperature
ClarificationUltracentrifugation (100,000×g)60 minutes at 4°C
Affinity ChromatographyHis-tag or GST-tag depending on constructLow imidazole wash to reduce non-specific binding
Ion ExchangeDEAE or SP SepharoseTest different pH values to optimize binding
Size ExclusionSuperdex 200Assess oligomeric state
ConcentrationCentrifugal filtration devicesAvoid protein aggregation

For membrane-associated proteins like colt, include detergent screening (starting with mild detergents like DDM or CHAPS) to identify optimal solubilization conditions. When expressing colt protein in Drosophila S2 cells, inducible metallothionein promoters provide controlled expression, potentially increasing yield and purity of the final product .

Verify protein identity and purity using western blotting and mass spectrometry. For functional assays, native purification conditions should be prioritized over denaturing methods to maintain protein activity .

How can CRISPR-Cas9 be optimized for precise modification of the colt gene in Drosophila?

Optimizing CRISPR-Cas9 for precise modification of the colt gene requires careful consideration of several key parameters:

  • Guide RNA (gRNA) Design:

    • Use algorithms specifically optimized for Drosophila genome to minimize off-target effects

    • Evaluate multiple gRNA candidates using scoring tools like CRISPOR or E-CRISP

    • Target conserved functional domains of the colt gene for maximum effect

    • Include proper controls for each gRNA to verify specificity

  • Delivery Method Optimization:

    • For germline editing: Inject components into pole cells of early embryos

    • Optimize injection timing (0-1 hour after egg laying)

    • Consider using Cas9 protein instead of mRNA for faster action and higher efficiency

  • Homology-Directed Repair (HDR) Enhancement:

    • Design repair templates with at least 1kb homology arms

    • Include visible markers (e.g., eye color) for easy screening

    • Use chemical inhibitors of non-homologous end joining (NHEJ) to promote HDR

  • Screening Strategy:

    • Establish a hierarchical screening approach: phenotypic screening followed by molecular verification

    • Use high-resolution melt analysis as a rapid pre-screening method

    • Verify modifications by sequencing and functional assays

The rapid generation time of Drosophila (10-14 days) allows for quick validation of genome editing results, making it an ideal system for optimizing CRISPR protocols for specific genes like colt .

What strategies can resolve conflicting data about colt protein function from different experimental approaches?

When facing conflicting data about colt protein function, employ these systematic resolution strategies:

  • Experimental Design Reconciliation:

    • Create a matrix comparing methodologies, genetic backgrounds, and environmental conditions

    • Identify variables that differ between conflicting studies

    • Design experiments that systematically test each variable's contribution to observed differences

  • Genetic Background Effects Analysis:

    • Back-cross strains to standardize genetic backgrounds

    • Use multiple independent strains to verify phenotypes

    • Create isogenic lines with and without colt mutations to eliminate confounding variables

  • Experimental Evolution Approach:

    • Establish replicated populations under different selection regimes related to colt function

    • Compare evolutionary trajectories to identify consistently selected traits

    • This approach can reveal robust phenotypes associated with colt across genetic backgrounds

  • Integrated Multi-omics Analysis:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Use network analysis to identify coherent functional modules

    • Integrate results across developmental stages and tissues

Laboratory evolution with Drosophila provides a powerful means to resolve conflicting results by creating replicated populations that can be differentiated relative to control populations using well-defined selection protocols. This approach allows researchers to use strong-inference tests of hypotheses concerning phenotypic and genetic responses related to colt function .

How can I design experiments to investigate the role of colt in tracheal development under stress conditions?

Designing experiments to investigate colt's role in tracheal development under stress requires a multifaceted approach:

  • Stress Condition Selection and Standardization:

    • Hypoxia: Use controlled oxygen chambers (5-15% O₂)

    • Oxidative stress: Apply paraquat or H₂O₂ at subtoxic concentrations

    • Temperature stress: Apply heat shock protocols (29-31°C)

    • Standardize intensity and duration for reproducibility

  • Developmental Timing Analysis:

    • Create detailed developmental timelines of tracheal development with and without stress

    • Use live imaging of fluorescently tagged colt protein to track dynamic responses

    • Compare developmental trajectories across multiple stress conditions

  • Genetic Interaction Networks:

    • Screen for genetic enhancers/suppressors specific to stress conditions

    • Use RNAi to knockdown stress-response genes in colt mutant backgrounds

    • Apply experimental evolution approaches to identify adaptive responses

  • Molecular Response Analysis:

Analysis TypeMethodOutput Measure
TranscriptionalqRT-PCR & RNA-seqDifferential gene expression
TranslationalPolysome profilingTranslation efficiency changes
Post-translationalPhosphoproteomicsStress-induced modifications
StructuralImmunostaining & confocal microscopyTracheal morphology changes

The Drosophila model allows researchers to rapidly test these complex interactions due to its short generation time and the availability of sophisticated genetic tools. The metazoan complexity of Drosophila provides valuable insights into stress responses in tracheal development that can be translated to other systems, while still maintaining experimental tractability .

What methodological considerations are important for studying colt protein-protein interactions using proteomics approaches?

When investigating colt protein-protein interactions using proteomics, consider these methodological factors:

  • Sample Preparation Optimization:

    • Developmental timing: Select precise developmental windows where colt is active

    • Tissue specificity: Use GAL4-UAS system for tissue-specific expression

    • Subcellular fractionation: Separate membrane, cytosolic, and nuclear fractions

    • Crosslinking optimization: Test multiple crosslinkers (DSS, formaldehyde) at varying concentrations

  • Affinity Purification Strategies:

    • Epitope tag selection: Compare FLAG, HA, and BioID tags for efficiency

    • Expression level control: Use inducible promoters to prevent artifacts from overexpression

    • Negative controls: Include parallel purifications from wild-type flies

    • Washing stringency: Develop graduated washing protocols to differentiate between high and low-affinity interactors

  • Mass Spectrometry Considerations:

    • Quantitative approaches: Use SILAC or TMT labeling for comparative analysis

    • Technical replicates: Minimum of three independent biological samples

    • Data analysis pipeline: Apply appropriate statistical filters (FDR <1%, enrichment >2-fold)

  • Validation Experiments:

    • Reciprocal pulldowns of identified interactors

    • Genetic interaction tests in vivo

    • Co-localization studies using high-resolution microscopy

The ability to maintain Drosophila populations with effective sizes on the order of 10³ provides sufficient statistical power to detect reliable protein-protein interactions while mitigating the confounding effects of genetic variation between experimental samples .

How can I set up experimental evolution studies to investigate adaptation related to colt protein function?

Setting up experimental evolution studies to investigate colt-related adaptation requires careful planning:

  • Selection Regime Design:

    • Direct selection: Apply environmental conditions that stress tracheal function

    • Indirect selection: Select for phenotypes known to correlate with tracheal development

    • Reverse selection: Return selected populations to ancestral conditions to test adaptation stability

  • Population Structure Establishment:

    • Maintain 3-5 replicate populations per selection regime

    • Use effective population sizes of ~1,000 individuals to balance genetic drift and selection

    • Control populations should be maintained in parallel under standard conditions

  • Phenotypic Assay Development:

    • Create quantitative assays for tracheal morphology

    • Measure physiological parameters related to tracheal function

    • Design high-throughput screening methods for large populations

  • Genetic Analysis Pipeline:

    • Periodic sampling for genomic analysis

    • Track allele frequencies at the colt locus and potential interactors

    • Apply whole-genome approaches to identify hitchhiking mutations

The Drosophila model is particularly advantageous for experimental evolution studies related to tracheal development because populations can be maintained with abundant genetic variation, allowing selection to produce physiological changes rapidly - in as few as 10 generations (less than 3 months) . This approach allows researchers to create populations of flies differentiated for chosen physiological characters related to colt function, facilitating the study of adaptive responses across multiple functional traits .

What are the most effective protocols for immunostaining colt protein in Drosophila tissues?

Optimized immunostaining protocol for colt protein detection in Drosophila tissues:

  • Tissue Preparation:

    • Dissect tissues in cold PBS

    • Fix in 4% paraformaldehyde for 20 minutes at room temperature

    • For tracheal tissues specifically: Use shorter fixation (15 minutes) to preserve epitope accessibility

  • Permeabilization and Blocking:

    • Permeabilize with PBT (PBS + 0.3% Triton X-100) for 30 minutes

    • Block with PBT + 5% normal goat serum for 1 hour at room temperature

    • For membrane proteins like colt: Add 0.1% saponin to improve antibody access

  • Antibody Incubation:

    • Primary antibody: Dilute in blocking solution, incubate overnight at 4°C

    • Washing: 3×15 minutes in PBT

    • Secondary antibody: Incubate 2 hours at room temperature

    • Final washes: 3×15 minutes in PBT, then 1×5 minutes in PBS

  • Troubleshooting Guidelines:

IssuePotential CauseSolution
No signalEpitope destructionReduce fixation time, try different fixatives
High backgroundNon-specific bindingIncrease blocking time, add 1% BSA to blocking solution
Uneven stainingInsufficient permeabilizationIncrease Triton X-100 concentration to 0.5%
Tissue damageOverfixationOptimize fixation time for specific tissue

The genetic versatility of Drosophila allows for creating control samples expressing tagged versions of colt protein, which can be used to validate antibody specificity and optimize staining protocols .

How do I resolve common issues in recombinant colt protein expression and purification?

Troubleshooting guide for recombinant colt protein expression and purification:

  • Low Expression Yield:

    • Issue: Protein toxicity in expression system

    • Solution: Use tightly regulated inducible promoters or lower induction temperatures

    • Alternative: Test different Drosophila cell lines (S2, Kc167) for expression

  • Protein Insolubility:

    • Issue: Formation of inclusion bodies

    • Solution: Express fusion constructs (MBP, SUMO) to enhance solubility

    • Alternative: Optimize lysis buffer conditions (pH, salt concentration, detergents)

  • Protein Degradation:

    • Issue: Proteolytic cleavage during purification

    • Solution: Add protease inhibitor cocktail, perform purification at 4°C

    • Analysis: Use western blotting to identify degradation patterns

  • Loss of Function After Purification:

    • Issue: Structural changes during purification

    • Solution: Include stabilizing agents (glycerol, specific ligands)

    • Validation: Compare activity of protein purified under different conditions

  • Aggregation During Storage:

    • Issue: Protein instability

    • Solution: Optimize buffer components (add reducing agents, adjust pH)

    • Storage: Test multiple storage conditions (-80°C, liquid nitrogen, lyophilization)

When expressing complex proteins like colt, consider the advantages of the Drosophila system, which allows for proper post-translational modifications and folding. The genetic tractability of Drosophila enables the creation of specialized expression strains optimized for specific proteins .

What are the latest genomic technologies being applied to study proteins like colt in Drosophila?

Recent genomic technologies that enhance the study of proteins like colt in Drosophila include:

  • Single-Cell Genomics Applications:

    • Single-cell RNA sequencing of tracheal cells to map colt expression patterns

    • Spatial transcriptomics to correlate colt expression with tissue architecture

    • Cell-specific ATAC-seq to identify regulatory elements controlling colt expression

    • These approaches provide unprecedented resolution of colt's role in specific cell types

  • Advanced CRISPR Applications:

    • Base editing for precise nucleotide modifications without double-strand breaks

    • Prime editing for targeted insertions and deletions with reduced off-target effects

    • CRISPRi/CRISPRa for reversible modulation of colt expression

    • These techniques allow for more sophisticated genetic manipulations than traditional mutagenesis

  • Integrative Multi-omics Platforms:

    • Combined analysis of transcriptomics, proteomics, and metabolomics data

    • Network analysis tools to position colt within broader biological pathways

    • Machine learning approaches to predict phenotypic outcomes of colt modifications

These genomic technologies leverage the well-characterized Drosophila genome to provide systematic assays of the molecular foundations underlying colt protein function. The cost-effective nature of these genomic tools in Drosophila makes them increasingly accessible for comprehensive studies .

How might findings about colt protein in Drosophila translate to human disease research?

Translating findings about colt protein from Drosophila to human disease research follows several strategic pathways:

  • Comparative Genomics Approach:

    • Identify human orthologs of colt through sequence and structural homology

    • Analyze conservation of functional domains across species

    • Study syntenic relationships to identify conserved regulatory mechanisms

    • This approach leverages the extensive genomic data available for both Drosophila and humans

  • Disease Model Development:

    • Engineer Drosophila to express human variants of colt orthologs

    • Screen for phenotypes that recapitulate human disease symptoms

    • Use modifier screens to identify potential therapeutic targets

    • The rapid generation time of Drosophila enables efficient testing of multiple disease variants

  • Therapeutic Target Validation:

    • Use Drosophila to perform high-throughput drug screening

    • Validate molecular mechanisms of candidate drugs

    • Test combination therapies for synergistic effects

    • This approach benefits from the complex metazoan physiology of Drosophila while retaining experimental tractability

  • Translational Research Pipeline:

Drosophila FindingTranslation ApproachHuman Application
Colt function in tissue developmentCompare with human ortholog expressionDevelopmental disorder insights
Genetic interactionsNetwork analysis across speciesPathway-based therapeutic approaches
Stress response mechanismsConserved cellular responsesStress-related pathology understanding

Drosophila serves as an ideal model for this translational approach because it combines the speed and ease of a microbial model with complex metazoan physiology relevant to human diseases . The wealth of genetic tools available for Drosophila allows researchers to rapidly test hypotheses about gene function that would be challenging to address directly in human systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.