Recombinant Drosophila melanogaster CTD nuclear envelope phosphatase 1 homolog (l (1)G0269)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Drosophila melanogaster CTD Nuclear Envelope Phosphatase 1 Homolog (l (1)G0269)

Recombinant Drosophila melanogaster CTD Nuclear Envelope Phosphatase 1 homolog, also known as CTDNEP1, is a protein phosphatase that plays a crucial role in various cellular processes, particularly in nuclear membrane biogenesis and lipid metabolism . It is the homolog of the yeast protein Nuclear Envelope Morphology 1 (NEM1) and C. elegans CNEP-1, sharing a conserved function in controlling the production of endoplasmic reticulum (ER) and nuclear membranes .

Role in Nuclear Membrane Biogenesis

CTDNEP1 is enriched at the nuclear envelope, where it maintains a stable, dephosphorylated pool of phosphatidic acid phosphatase lipin 1 . Lipin 1 is a key enzyme that produces diacylglycerol (DAG) in the ER . CTDNEP1 opposes stimulatory signals from nutrient-sensing pathways that retain phosphorylated lipin 1 in the cytoplasm . Dephosphorylated lipin 1 is nuclear-localized and restricts the transcription of fatty acid synthesis genes . In CTDNEP1 knockout cells, lipin 1 becomes hyperphosphorylated, leading to an increased biochemical flux of fatty acid synthesis and excess ER membrane production .

Regulation of CTDNEP1 Activity

The activity and stability of CTDNEP1 are regulated by several mechanisms. An N-terminal amphipathic helix (AH) targets CTDNEP1 to the ER and nuclear envelope, where it can be degraded by the proteasome or stabilized through interaction with NEP1R1 . NEP1R1, or Nuclear Envelope Phosphatase-Regulatory Subunit 1 homolog, acts as a membrane scaffold for CTDNEP1 stabilization . Binding to NEP1R1 promotes the phosphatase activity of CTDNEP1 towards lipin 1, counteracting mTORC1-mediated cytoplasmic retention of lipin 1 .

CTDNEP1 and Lipid Droplet Biogenesis

CTDNEP1 also plays a role in limiting oleic-acid-induced lipid droplet biogenesis, but this function is independent of NEP1R1 binding . In the presence of excess fatty acids, the regulation of CTDNEP1 is rewired, potentially controlling a pool of lipin 1 or other substrates important for lipid droplet biogenesis .

Interaction with NEP1R1

CTDNEP1 interacts with NEP1R1 through a specific hydrophobic interface. Mutation of key residues in this interface disrupts the binding between CTDNEP1 and NEP1R1, affecting CTDNEP1's ability to dephosphorylate lipin 1 and regulate ER membrane biogenesis .

Table 1: Effects of CTDNEP1 and NEP1R1 Mutations on Lipin 1 Dephosphorylation and ER Size

MutationLipin 1 DephosphorylationER Size
CTDNEP1 KnockoutDecreasedIncreased
CTDNEP1(V233E)DecreasedIncreased
siRNA depletion of NEP1R1-Increased
F30E Flag-NEP1R1-No rescue of ER expansion

Functional Significance

CTDNEP1 is essential for maintaining proper ER membrane biogenesis, regulating lipid metabolism, and preventing excess ER expansion . Its function is conserved across species, highlighting its importance in cellular homeostasis .

Conservation of Compound Activity

Studies in Drosophila have shown a high degree of conservation of compound activity between Drosophila and vertebrates, making it a valuable model organism for studying compound mechanisms of action .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Dd; l(1)G0269; CG1696; CTD nuclear envelope phosphatase 1 homolog; Serine/threonine-protein phosphatase dullard homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Dd
Target Protein Sequence
MISLLQMKFRALLLLLSKVWTCICFMFNRQVRAFIQYQPVKYELFPLSPVSRHRLSLVQR KTLVLDLDETLIHSHHNAMPRNTVKPGTPHDFTVKVTIDRNPVRFFVHKRPHVDYFLDVV SQWYDLVVFTASMEIYGAAVADKLDNGRNILRRRYYRQHCTPDYGSYTKDLSAICSDLNR IFIIDNSPGAYRCFPNNAIPIKSWFSDPMDTALLSLLPMLDALRFTNDVRSVLSRNLHLH RLW
Uniprot No.

Target Background

Function
This serine/threonine protein phosphatase may dephosphorylate and activate lipin-like phosphatases. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol, regulating fatty acid metabolism. This phosphatase may indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes, and is potentially required for proper nuclear membrane morphology and/or dynamics. It may also indirectly regulate lipid droplet production and triacylglycerol levels.
Gene References Into Functions
  1. Dullard phosphatase dephosphorylates the Drosophila R-Smad, Mad, and plays a crucial role in controlling BMP signal duration. PMID: 27578171
  2. Manipulating Drosophila dullard (ddd) or Lipin gene expression levels affects wing vein formation, suggesting a negative impact on bone morphogenetic protein signaling. PMID: 21790556
Database Links

KEGG: dme:Dmel_CG1696

STRING: 7227.FBpp0076921

UniGene: Dm.7059

Protein Families
Dullard family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Drosophila melanogaster CTD Nuclear Envelope Phosphatase 1 and its significance in research?

CTDNEP1 in Drosophila melanogaster (l(1)G0269) is a member of the CTD phosphatase family with conserved phosphatase activity. Like its homologs in other organisms, the Drosophila CTDNEP1 contains a phosphatase domain in its C-terminal region and transmembrane domains in its N-terminal region. The protein is significant in research due to its involvement in crucial cellular processes including nuclear envelope biogenesis and potential roles in developmental pathways .

The evolutionary conservation of CTDNEP1 across species makes the Drosophila homolog particularly valuable for comparative studies. Research with this protein allows scientists to leverage the genetic tractability of Drosophila while studying a protein whose functions appear to be maintained from yeast to humans. This conservation suggests fundamental biological importance that predates the divergence of these species .

When studying l(1)G0269, researchers should note that it shares the characteristic DXDX(T/V) active site motif found in other CTDNEP1 homologs, which is critical for its phosphatase activity. Understanding this protein in Drosophila can provide insights applicable to higher organisms while taking advantage of the well-established genetic tools available in the fly model system.

How is CTDNEP1 function conserved between Drosophila and other organisms?

CTDNEP1 function displays remarkable evolutionary conservation across species. In Drosophila, as in other organisms, CTDNEP1 likely maintains key functional roles:

  • Nuclear envelope biogenesis: Like its yeast homolog NEM1, Drosophila CTDNEP1 is expected to be involved in nuclear membrane formation and maintenance. In yeast, NEM1 works together with SPO7 to regulate PAH1, a phosphatidic acid phosphatase. The human CTDNEP1 similarly dephosphorylates LIPIN1 (the human PAH1 ortholog) . This conservation suggests that Drosophila CTDNEP1 likely participates in similar pathways regulating nuclear envelope structure.

  • Developmental roles: While CTDNEP1 was initially identified in neuronal tissues of Xenopus laevis, its involvement in developmental processes appears to be maintained across species. In Drosophila, it likely contributes to developmental pathways, particularly in neuronal tissues, similar to other CTD phosphatases like Fcp1 that are essential for normal Drosophila development .

  • Partner protein interactions: In yeast, NEM1 interacts with SPO7 to form a functional complex. Similarly, human CTDNEP1 interacts with NEP1-R1 (formerly TMEM188, the human SPO7 ortholog). Researchers should investigate whether Drosophila CTDNEP1 requires a similar partner protein for full functionality .

The functional conservation of CTDNEP1 makes Drosophila an excellent model system for studying the basic mechanisms of this protein while providing insights relevant to its function in other organisms including humans.

How can researchers verify the activity of recombinant CTDNEP1?

Verifying the phosphatase activity of recombinant Drosophila CTDNEP1 is essential for functional studies. Researchers should implement a multi-pronged approach:

  • Phosphatase activity assays:

    • pNPP (para-nitrophenyl phosphate) colorimetric assay: This general phosphatase substrate can provide initial confirmation of activity, measuring absorbance at 405 nm after incubation

    • Malachite green assay: For quantifying released phosphate from physiological substrates

    • Radiolabeled substrate assay: Using 32P-labeled potential substrates for highly sensitive detection

  • Mutation analysis validation:

    • Generate mutants of the conserved DXDX(T/V) motif in the active site, which should abolish phosphatase activity

    • Compare wild-type and mutant activity in parallel assays as essential controls

  • Substrate specificity testing:

    • Test phosphorylated peptides from potential Drosophila substrates (likely including the Drosophila LIPIN homolog)

    • Compare activity against different phosphorylated residues (Ser, Thr, Tyr)

    • Include phosphorylated CTD peptides from RNA polymerase II to test cross-reactivity with other phosphatase targets

  • In vivo validation:

    • Rescue experiments in CTDNEP1-depleted Drosophila cells

    • Nuclear envelope morphology assessment using electron microscopy or fluorescent markers

    • Complementation tests with yeast or human homologs to confirm functional conservation

Researchers should always include appropriate controls:

  • Substrate-only controls

  • Heat-inactivated enzyme controls

  • Phosphatase inhibitor controls (okadaic acid or calyculin A at appropriate concentrations)

  • Known active phosphatases as positive controls

When interpreting results, consider that CTDNEP1 likely has narrow substrate specificity, so general phosphatase substrates may show lower activity than physiological targets.

What genetic approaches are most effective for studying CTDNEP1 function in Drosophila?

Several genetic approaches can be employed to study the function of CTDNEP1 (l(1)G0269) in Drosophila melanogaster:

  • RNA interference (RNAi):

    • UAS-RNAi lines can be crossed with tissue-specific GAL4 drivers to knock down CTDNEP1 expression in specific tissues

    • Multiple independent RNAi lines should be tested to control for off-target effects

    • Efficacy should be validated using RT-qPCR or Western blotting

    • Similar RNAi approaches have proven effective for studying CTD phosphatases like Fcp1 in Drosophila

  • CRISPR/Cas9 gene editing:

    • Generation of null mutations or specific point mutations in the conserved phosphatase domain

    • Creation of fluorescent protein fusions for localization studies

    • Engineering conditional alleles using FLP/FRT or similar systems for clonal analysis

  • Gal4/UAS misexpression studies:

    • Overexpression of wild-type or mutant forms of CTDNEP1

    • Similar approaches with Fcp1 have shown that misregulation results in developmental abnormalities

    • Expression of tagged versions for protein localization studies, similar to studies showing Fcp1 binding to specific regions of polytene chromosomes

  • Genetic interaction studies:

    • Cross CTDNEP1 mutants with flies carrying mutations in potential interacting proteins

    • Analyze double heterozygous combinations for enhancement or suppression of phenotypes

    • Focus on genes involved in nuclear envelope formation and phospholipid metabolism based on known interactions in other organisms

  • Cross-species rescue experiments:

    • Test whether homologs from yeast, Xenopus, or human can rescue Drosophila CTDNEP1 mutant phenotypes

    • Similar experiments with Fcp1 have shown that Xenopus homologs can substitute for Drosophila genes, indicating strong functional conservation

When interpreting results from these genetic approaches, researchers should be aware that complete loss of CTDNEP1 might cause lethality, as observed with other essential CTD phosphatases like Fcp1 . Therefore, conditional or tissue-specific approaches may be necessary to study function in later developmental stages.

How does CTDNEP1 regulate nuclear envelope biogenesis in Drosophila?

The role of CTDNEP1 in nuclear envelope biogenesis appears to be conserved from yeast to humans, with Drosophila likely utilizing similar mechanisms. Based on studies in other organisms, the following model can be proposed for Drosophila:

  • Drosophila CTDNEP1 likely forms a complex with a SPO7 ortholog (similar to human NEP1-R1/TMEM188) at the nuclear envelope . This complex would target and dephosphorylate a Drosophila homolog of PAH1/LIPIN.

  • The dephosphorylation cascade proceeds as follows:

    • Phosphorylated Drosophila LIPIN homolog is inactive or improperly localized

    • CTDNEP1 dephosphorylates specific serine/threonine residues on LIPIN

    • Dephosphorylated LIPIN is activated and properly localized

    • Active LIPIN converts phosphatidic acid (PA) to diacylglycerol (DAG)

    • This lipid remodeling promotes nuclear membrane biogenesis and maintenance

  • Researchers investigating this pathway should examine:

    • Changes in nuclear morphology following CTDNEP1 knockdown using electron microscopy or nuclear envelope markers

    • Phosphorylation state of the Drosophila LIPIN homolog in the presence/absence of CTDNEP1

    • Lipid composition changes (particularly PA and DAG levels) at the nuclear envelope

    • Localization dependencies between CTDNEP1 and its potential partner proteins

  • Expected phenotypes based on other systems:

    • Loss of CTDNEP1 would likely lead to nuclear membrane abnormalities

    • Overexpression of phosphomimetic LIPIN mutants should phenocopy CTDNEP1 loss

    • Constitutively active LIPIN might rescue CTDNEP1 deficiency

    • Active CTDNEP1 from Drosophila might rescue nuclear envelope phenotypes in yeast cells, while inactive mutants would not

For advanced studies, researchers should combine phosphoproteomics with lipidomics to comprehensively map the downstream effects of CTDNEP1 activity on both protein phosphorylation states and membrane lipid composition.

What is the relationship between CTDNEP1 and other CTD phosphatases in Drosophila?

Drosophila melanogaster possesses multiple CTD phosphatases, including CTDNEP1 (l(1)G0269) and Fcp1, each with distinct but potentially overlapping functions. Understanding their relationship is crucial for comprehensive phosphatase studies:

Researchers investigating the relationship between these phosphatases should consider:

  • Double knockdown/knockout experiments to identify synthetic interactions

  • Phosphoproteomics analysis comparing substrate profiles

  • Cross-rescue experiments testing if overexpression of one phosphatase can compensate for loss of another

  • Temporal and spatial expression pattern comparison throughout development

How can researchers address inconsistent phosphatase activity in recombinant CTDNEP1 preparations?

Inconsistent phosphatase activity in recombinant Drosophila CTDNEP1 preparations is a common challenge that can stem from multiple sources. Researchers should implement the following systematic troubleshooting approach:

  • Protein quality assessment:

    • Verify protein purity using SDS-PAGE and check for degradation products

    • Confirm proper folding using circular dichroism or limited proteolysis

    • Assess oligomerization state using size exclusion chromatography or native PAGE

    • Consider adding 6% trehalose to storage buffer to enhance stability, as used with recombinant Drosophila CTDNEP1 homologs

  • Expression system optimization:

    • Compare activity of protein expressed in different systems (bacterial, insect cell, Drosophila cell)

    • Test different purification strategies to minimize exposure to potentially inhibitory conditions

    • Verify that the affinity tag position (N- or C-terminal) doesn't interfere with activity

    • Consider co-expression with potential partner proteins (SPO7 ortholog) that might be required for full activity

  • Assay condition optimization:

    • Test multiple buffer systems (HEPES, Tris, MES) at pH ranges 6.5-8.0

    • Optimize divalent cation requirements (Mg2+, Mn2+) at concentrations from 1-10 mM

    • Test reducing agent requirements (DTT, β-mercaptoethanol) at 1-5 mM

    • Examine salt sensitivity by varying NaCl concentration from 50-250 mM

    • Determine temperature optima, typically ranging from 25-37°C

  • Substrate-specific considerations:

    • Test multiple substrate types (pNPP, physiological phosphopeptides)

    • For potential physiological substrates like LIPIN homologs, verify their phosphorylation status

    • Consider that CTDNEP1 may have narrow substrate specificity, so general phosphatase substrates might show lower or variable activity

  • Common pitfalls and solutions:

    • Metal ion contamination: Include EDTA in early purification steps, then remove before activity assays

    • Freeze-thaw damage: Aliquot protein and avoid repeated freeze-thaw cycles

    • Oxidation: Maintain reducing environment during storage and assays

    • Autoinhibition: Test truncation constructs to identify potential autoinhibitory domains

A standardized quality control workflow should include:

  • Regular testing against a standard substrate batch

  • Inclusion of known active phosphatase controls in each assay

  • Verification of activity immediately after purification and after storage

How can researchers distinguish between direct and indirect CTDNEP1 effects in developmental studies?

Distinguishing direct from indirect effects of CTDNEP1 in Drosophila developmental studies requires rigorous experimental design and multiple complementary approaches:

  • Temporal control strategies:

    • Use temperature-sensitive or drug-inducible systems (Gal80ts or GeneSwitch) to induce CTDNEP1 disruption at specific developmental time points

    • Rapid induction systems can help separate immediate (likely direct) from delayed (likely indirect) effects

    • Time-course analyses after CTDNEP1 manipulation to track the order of phenotypic changes

  • Substrate-specific approaches:

    • Generate phosphosite-specific antibodies against predicted CTDNEP1 substrates

    • Perform phosphoproteomics immediately after CTDNEP1 inactivation to identify rapidly changing phosphorylation sites

    • Validate direct substrates using in vitro phosphatase assays with purified components

    • Create non-phosphorylatable and phosphomimetic mutants of putative substrates and test for phenocopy of CTDNEP1 manipulation

  • Domain-specific manipulations:

    • Generate catalytically inactive mutants (mutations in the DXDX(T/V) motif) that maintain proper localization

    • Compare phenotypes between catalytically inactive mutants and complete knockouts

    • Create separation-of-function mutants that affect specific protein-protein interactions

  • Rescue experiments with increasing specificity:

    • Test whether wild-type CTDNEP1 rescues the mutant phenotype

    • Test whether catalytically inactive CTDNEP1 rescues any aspects of the phenotype (suggesting scaffold functions)

    • Test whether constitutively active forms of known substrates (e.g., dephospho-mimetics of LIPIN) bypass the need for CTDNEP1

  • Analysis of nuclear envelope phenotypes:

    • Defects in nuclear envelope structure are likely direct effects of CTDNEP1 disruption based on its conserved role

    • Secondary effects might include transcriptional changes, cell cycle defects, or altered signaling pathways

    • Electron microscopy of nuclear envelope structure provides direct assessment of CTDNEP1's primary function

When interpreting results, researchers should remember that CTDNEP1's roles in nuclear membrane biogenesis likely lead to numerous downstream effects due to the fundamental importance of nuclear envelope integrity for many cellular processes. Careful temporal and molecular dissection is essential for accurately classifying observed phenotypes as direct or indirect.

What are emerging techniques for studying CTDNEP1 interactomes in Drosophila?

Advanced techniques for mapping the CTDNEP1 interactome in Drosophila are rapidly evolving. Researchers should consider these cutting-edge approaches:

  • Proximity-based labeling techniques:

    • BioID or TurboID fusion with CTDNEP1 to identify proteins in close proximity at the nuclear envelope

    • APEX2-based proximity labeling for temporal control of labeling reactions

    • Split-BioID systems to identify interactions that occur only in specific cellular contexts

    • These methods are particularly valuable for membrane proteins like CTDNEP1 where traditional immunoprecipitation may disrupt weak or detergent-sensitive interactions

  • Cross-linking mass spectrometry (XL-MS):

    • In vivo crosslinking followed by mass spectrometry to capture direct protein-protein interactions

    • MS-cleavable crosslinkers to improve identification of crosslinked peptides

    • Targeted XL-MS focusing on nuclear envelope fractions to enrich for relevant interactions

  • Optical techniques for interaction validation:

    • Förster Resonance Energy Transfer (FRET) between fluorescently tagged CTDNEP1 and candidate interactors

    • Fluorescence Correlation Spectroscopy (FCS) to measure co-diffusion of CTDNEP1 with partners

    • Single-molecule tracking to analyze dynamic interactions at the nuclear envelope

  • Functional proteomics approaches:

    • Parallel genetic screens to identify enhancers and suppressors of CTDNEP1 phenotypes

    • Systematic CRISPR screening of candidates identified in physical interaction studies

    • Thermal proteome profiling (TPP) to identify proteins whose stability is affected by CTDNEP1 activity

  • Tissue-specific interactome mapping:

    • Cell type-specific expression of tagged CTDNEP1 using the GAL4/UAS system

    • Translating ribosome affinity purification (TRAP) combined with proximity labeling for tissue-specific interaction maps

    • Single-cell proteomics to identify cell type-specific interaction patterns

These techniques should be applied with particular focus on identifying the Drosophila homologs of known interactors in other species, such as the SPO7 ortholog (similar to human NEP1-R1/TMEM188) and potential substrates like the LIPIN homolog . The comprehensive interactome would provide a framework for understanding how CTDNEP1 functions within larger protein networks controlling nuclear envelope dynamics.

What potential non-canonical functions of CTDNEP1 warrant investigation in Drosophila?

Beyond its established roles in nuclear envelope biogenesis and lipid metabolism, Drosophila CTDNEP1 may have several non-canonical functions that deserve investigation:

  • Transcriptional regulation:

    • Other CTD phosphatases like Fcp1 directly regulate RNA polymerase II through CTD dephosphorylation

    • CTDNEP1 might similarly influence transcription through as-yet-unidentified nuclear substrates

    • Research approach: RNA-seq and ChIP-seq in CTDNEP1 mutant backgrounds to identify affected genes

    • Potential technique: Targeted DamID to determine if CTDNEP1 associates with specific chromatin regions

  • Cell cycle regulation:

    • Nuclear envelope dynamics are closely tied to cell cycle progression

    • CTDNEP1 might coordinate nuclear envelope remodeling with cell cycle checkpoints

    • Research approach: Live imaging of cell cycle progression in CTDNEP1-depleted cells

    • Investigation of genetic interactions with cell cycle regulators

  • Stress response pathways:

    • Nuclear envelope integrity is crucial during cellular stress

    • CTDNEP1 might be involved in stress-induced nuclear remodeling

    • Research approach: Examine CTDNEP1 activity and localization under various stress conditions

    • Proteomics to identify stress-specific CTDNEP1 substrates or interactors

  • Non-nuclear membrane functions:

    • Though primarily associated with the nuclear envelope, CTDNEP1 might act on other membrane systems

    • Potential roles in ER structure, Golgi dynamics, or mitochondrial membranes

    • Research approach: High-resolution imaging of various membrane systems in CTDNEP1 mutants

    • Lipidomics analysis of different cellular membrane fractions

  • Signaling pathway integration:

    • CTDNEP1 has been implicated in bone morphogenetic protein (BMP) signaling regulation

    • Investigate potential roles in other conserved signaling pathways in Drosophila

    • Research approach: Systematic testing of genetic interactions with components of major signaling pathways

    • Phosphoproteomics to identify signaling pathway components affected by CTDNEP1 disruption

  • RNA metabolism:

    • Given the "CTD" designation and relation to other CTD phosphatases that regulate RNA polymerase II

    • CTDNEP1 might influence RNA processing, export, or stability

    • Research approach: RNA-IP followed by sequencing to identify RNAs associated with CTDNEP1 complexes

    • Analysis of RNA processing and export in CTDNEP1 mutant backgrounds

For each of these potential functions, researchers should design experiments that can distinguish direct from indirect effects, using the approaches outlined in previous sections, particularly rapid induction systems and direct substrate identification methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.