Recombinant Drosophila melanogaster Cyclic nucleotide-gated cation channel (Cng)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

The Drosophila Cng channel exhibits distinct biophysical properties compared to vertebrate homologs:

PropertyValue/Detail
Ligand Sensitivity~50-fold higher sensitivity to cGMP vs. cAMP
Ca²⁺ PermeabilityHigher Ca²⁺ permeability than rod photoreceptor CNG channels
Divalent Cation BlockWeak Ca²⁺ block due to threonine at residue 318 (vs. proline in vertebrates)
Voltage DependenceDistinct blockage by divalent cations compared to rod channels

Structural Basis of Weak Ca²⁺ Block
The DmCng channel’s selectivity filter (TIGETPPP) adopts a flexible conformation due to a threonine (T318) replacing the conserved proline found in vertebrate channels. This structural difference reduces Ca²⁺ binding affinity, weakening Ca²⁺ block. Mutating T318 to proline (T318P) increases Ca²⁺-blocking affinity by 16-fold, restoring vertebrate-like block characteristics .

Expression and Purification

The recombinant protein is produced in E. coli and purified via affinity chromatography. Key experimental parameters include:

ParameterDetail
Expression SystemE. coli
Purification MethodHis-tag affinity chromatography
Storage Conditions-20°C or -80°C, avoid repeated freeze-thaw cycles
Reconstitution SolventDeionized water or buffer with glycerol (50% recommended)

The protein is lyophilized for long-term stability and reconstituted at 0.1–1.0 mg/mL for functional assays .

Research Findings and Applications

Sensory Transduction Roles

  • Photoreception: Expressed in Drosophila eyes, where it mediates light-dependent cGMP signaling .

  • Olfaction: mRNA detected in antennae, suggesting involvement in odorant detection .

  • Ca²⁺ Signaling: High Ca²⁺ permeability enables Ca²⁺-dependent signaling in sensory neurons .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill them as requested.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
CngA; Cng; CG7779; Cyclic nucleotide-gated cation channel subunit A; Cyclic nucleotide-gated ion channel subunit A; CNG channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-665
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CngA
Target Protein Sequence
MRHFKVKAMVQSLDISAITGQQTDAEPSKRSKPSALRRTLQALRQRLTKRNRPKPPDWFL EKFSNTTNTDKIGKGCPAMEDAALSSEIRGSSVLCNRLSVDPTLQSHYRWLAIVSLAVLY NIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRR HYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTE TATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVYNLNGTRNNTLQRQYI YSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEF QNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVH MDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDD GITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPE ARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYT ASQAKIKQRLAKLEMNGGPGTWRLECEPQSRARSGRLYSLQPKRRPRSRPDATAKSSDAA KQNTL
Uniprot No.

Target Background

Function
This protein exhibits approximately 50-fold greater sensitivity to cGMP compared to cAMP. It potentially plays a role in transduction cascades within both invertebrate photoreceptors and olfactory sensillae.
Database Links
Protein Families
Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in antennae and the visual system.

Q&A

What is the basic structure of Drosophila melanogaster CNG channels?

Drosophila CNG channels are tetrameric membrane proteins with structural similarities to vertebrate CNG channels. Each subunit contains six transmembrane segments (S1-S6) with a pore region (P-loop) between S5 and S6. The cyclic nucleotide binding domain is located near the C-terminal region of each subunit . The Drosophila CNG channel gene (DmCNGC) consists of at least seven exons, as revealed through genomic DNA analysis .

How do CNG channels function in Drosophila sensory systems?

CNG channels in Drosophila function as downstream targets in signaling pathways similar to their role in vertebrate systems. These non-selective cation channels allow the flux of Na⁺, K⁺, and Ca²⁺ ions in response to the binding of cyclic nucleotides (cAMP or cGMP) to an intracellular binding domain . This binding triggers the opening of an internal membrane pore, resulting in membrane depolarization .

In sensory systems, particularly in eyes and antennae, CNG channels play crucial roles in signal transduction. Expression analysis using RT-PCR has confirmed the presence of CNG channel mRNA in both antennae and eyes of adult Drosophila . The Drosophila CNG channel exhibits approximately 50-fold higher sensitivity to cGMP than to cAMP, suggesting a preferential role in cGMP-dependent signaling pathways .

What evidence supports the presence of CNG channels in Drosophila motor neurons?

The functional significance of these channels in motor neurons was demonstrated through behavioral and electrophysiological studies using CNGL mutants. Disruption of the CNGL gene affected larval locomotion patterns and caused synaptic irregularities, suggesting that CNG channels play important roles in regulating rhythmic behaviors such as peristaltic locomotion .

How do the electrophysiological properties of Drosophila CNG channels differ from vertebrate CNG channels?

Drosophila CNG channels exhibit distinct electrophysiological properties compared to their vertebrate counterparts, particularly regarding ion selectivity and blockage by divalent cations. Research has demonstrated that the voltage dependence of blockage by divalent cations differs significantly between Drosophila CNG channels and vertebrate rod photoreceptor CNG channels .

Current-voltage recordings obtained from outside-out patches of Xenopus oocyte membranes expressing Drosophila CNG channels revealed different sensitivity to Ca²⁺ blockage. The dose-dependent Ca²⁺ blockage at -60 mV for Drosophila CNG channels showed a mean K₁ value of 229.2 ± 43.6 μM with a Hill coefficient (n) of 0.87 ± 0.14, whereas the bovine rod CNG channel exhibited a K₁ value of 4.1 ± 1.0 μM . This approximately 56-fold difference in Ca²⁺ sensitivity indicates fundamental differences in ion permeation properties between these channels.

What genomic organization characterizes the Drosophila CNG channel gene, and how does it compare to vertebrate CNG channel genes?

The genomic organization of the Drosophila CNG channel gene (DmCNGC) has been determined through sequencing of 7.5 kb of genomic DNA. Comparison between genomic and cDNA nucleotide sequences revealed that the DmCNGC gene comprises seven exons. While consensus sequences for splice donor/acceptor sites are observed at most exon/intron boundaries, the genomic sequence differs in one position from the cDNA sequence .

What is the relationship between CNG channel function and locomotor behavior in Drosophila larvae?

Research investigating CNGL mutants has revealed complex relationships between CNG channel function and locomotor behavior in Drosophila larvae. Contrary to initial hypotheses that predicted decreased synaptic activity and lower average velocity in CNGL mutants, behavioral analysis demonstrated that disruption of CNGL channels resulted in higher average velocity but lower average cumulative distance traveled compared to control larvae .

This paradoxical finding suggests that CNG channels play nuanced roles in coordinating rhythmic locomotor patterns. Electrophysiological recordings from body-wall muscles of CNGL mutants confirmed synaptic irregularities that correlated with defects in fictive locomotive activity patterns . These observations indicate that CNG channels are essential for maintaining proper excitation-inhibition balance in neural circuits controlling locomotion.

The data suggest that CNG channels may function not only in motor neurons but also in central pattern generators (CPGs) that regulate rhythmic behaviors. The disruption of peristaltic patterns observed in CNGL mutants points to broader roles for these channels in neural circuit function beyond direct neuromuscular transmission .

What expression systems are effective for studying recombinant Drosophila CNG channels?

Heterologous expression systems have proven effective for studying the functional properties of recombinant Drosophila CNG channels. Research has successfully employed both Xenopus oocytes and HEK 293 cells for expression of cloned Drosophila CNG channel cDNA . These expression systems allow detailed electrophysiological characterization of channel properties using techniques such as patch-clamp recording.

The procedure typically involves:

  • Cloning of genomic DNA and cDNA encoding the Drosophila CNG channel

  • Preparation of the expression vector containing the complete coding region

  • Transfection or injection of the expression construct into Xenopus oocytes or HEK 293 cells

  • Verification of functional expression through electrophysiological recordings

  • Characterization of channel properties including cyclic nucleotide sensitivity, ion selectivity, and voltage dependence

This approach has revealed important functional characteristics of Drosophila CNG channels, including their higher sensitivity to cGMP compared to cAMP and distinct patterns of divalent cation blockage .

How can tissue-specific expression of Drosophila CNG channels be analyzed?

Analysis of tissue-specific expression of Drosophila CNG channels can be accomplished using reverse transcriptase-polymerase chain reaction (RT-PCR) amplification. This approach allows for the detection of channel-specific mRNA in different tissues and developmental stages .

The methodology involves:

  • Isolation of total RNA from specific tissues (e.g., antennae, eyes, heads, bodies)

  • Synthesis of first-strand cDNA using reverse transcriptase

  • PCR amplification using primers designed to discriminate between cDNA and contaminating genomic DNA

  • Analysis of PCR products by gel electrophoresis

  • Confirmation of product identity through sequencing

For example, researchers used primers that annealed to the 3' end of exon 4 and the 5' end of exon 5 of the DmCNGC gene, resulting in expected fragment lengths of 332 bp from cDNA and 1450 bp from genomic DNA. This approach successfully identified CNG channel expression in antennae, eyes, and heads of wild-type Drosophila .

What genetic approaches can be used to study CNG channel function in Drosophila?

Genetic manipulation provides powerful tools for studying CNG channel function in Drosophila. One effective approach involves using MiMIC (Minos Mediated Integration Cassette) mutations to disrupt CNG channel genes. This technique allows for the insertion of a transposon that renders the target gene non-functional .

The genetic approach typically includes:

  • Generation or selection of appropriate MiMIC lines targeting the CNG channel gene of interest

  • Verification of gene disruption through molecular techniques such as PCR

  • Behavioral analysis of mutant phenotypes through video recording and tracking of spontaneous behaviors

  • Electrophysiological characterization of synaptic function in mutants

  • Rescue experiments to confirm specificity by reintroducing the functional gene in specific neurons

For example, researchers used a MiMIC mutation to disrupt the CNGL gene in Drosophila larvae and analyzed the effects on locomotor behavior. The spontaneous crawling behavior of CNGL mutant and control larvae was recorded, tracked, and analyzed to quantify parameters such as velocity and cumulative distance traveled. Additionally, electrophysiological recordings from body-wall muscles provided insights into synaptic irregularities associated with the mutation .

How should electrophysiological data from CNG channel recordings be analyzed?

Analysis of electrophysiological data from CNG channel recordings requires specific approaches to extract meaningful information about channel properties. Key analytical methods include:

  • Current-Voltage Relationship Analysis:

    • Plot current amplitude against membrane potential to assess voltage dependence

    • Analyze rectification properties and reversal potentials to determine ion selectivity

    • Fit data to appropriate mathematical models to extract parameters such as conductance

  • Dose-Response Analysis:

    • Measure current responses to varying concentrations of cyclic nucleotides

    • Fit data to Hill equation: I/Imax = [cNMP]^n / ([cNMP]^n + K₁/₂^n)

    • Determine K₁/₂ (half-maximal effective concentration) and Hill coefficient (n)

  • Divalent Cation Blockage Analysis:

    • Measure current amplitudes at different divalent cation concentrations

    • Plot normalized current (I/Imax) against voltage at various Ca²⁺ concentrations

    • Calculate dose dependence of Ca²⁺ blockage at specific voltages (e.g., -60 mV)

    • Compare parameters such as K₁ values between different channel types

For example, in Drosophila CNG channel studies, current-voltage recordings obtained from outside-out patches of Xenopus oocyte membranes were analyzed to determine the voltage dependence of current ratio I/Imax at various Ca²⁺ concentrations and to calculate dose dependence of Ca²⁺ blockage .

What behavioral parameters are most informative when studying CNG channel mutants in Drosophila?

When studying CNG channel mutants in Drosophila, several behavioral parameters provide valuable insights into channel function in vivo:

Research on CNGL mutants demonstrated that disruption of CNG channels affected multiple behavioral parameters, including increased average velocity but decreased cumulative distance traveled, suggesting abnormal patterns of movement rather than simple hypo- or hyperactivity . These findings highlight the importance of analyzing multiple behavioral parameters to fully characterize the effects of CNG channel mutations.

How can gene expression data for CNG channels be quantified and compared across different neuronal subtypes?

Quantification and comparison of CNG channel gene expression across different neuronal subtypes requires specialized techniques that combine molecular biology with neuron-specific labeling. Effective approaches include:

  • Cell-Type Specific Transcriptomics:

    • Fluorescence-Activated Cell Sorting (FACS) of genetically labeled neurons

    • Single-cell RNA sequencing of identified neuron populations

    • Translating Ribosome Affinity Purification (TRAP) to isolate mRNAs from specific cell types

    • Comparative analysis of expression levels using appropriate statistical methods

  • Quantitative PCR Approaches:

    • Design of gene-specific primers for CNG channel subunits

    • Isolation of RNA from identified neuron populations

    • Reverse transcription followed by quantitative PCR

    • Normalization to appropriate reference genes

    • Statistical comparison across neuronal subtypes

  • In Situ Hybridization:

    • Design of RNA probes targeting CNG channel mRNAs

    • Combination with immunohistochemistry for neuron-type markers

    • Quantification of signal intensity in identified neurons

    • Statistical analysis of expression differences

What are the major technical challenges in studying recombinant Drosophila CNG channels?

Researchers face several significant technical challenges when studying recombinant Drosophila CNG channels:

  • Expression System Limitations:

    • Achieving sufficient expression levels for functional studies

    • Ensuring proper post-translational modifications and trafficking

    • Avoiding non-physiological aggregation or misfolding

    • Establishing stable cell lines with consistent expression

  • Electrophysiological Recording Challenges:

    • Low signal-to-noise ratio in recordings from channels with small conductance

    • Distinguishing CNG channel currents from endogenous currents

    • Maintaining stable recording conditions during cyclic nucleotide application

    • Achieving adequate voltage control in recordings from complex neuronal morphologies

  • Subunit Composition Determination:

    • Identifying potential heteromeric assemblies of different subunits

    • Determining stoichiometry of subunits in functional channels

    • Reconstituting native-like channel complexes in heterologous systems

    • Characterizing contributions of individual subunits to channel properties

Overcoming these challenges requires optimization of expression systems, refinement of electrophysiological techniques, and development of experimental approaches that faithfully recapitulate the native environment of these channels .

How might differences between Drosophila and vertebrate CNG channels inform evolutionary understanding of these proteins?

Comparative analysis of Drosophila and vertebrate CNG channels provides valuable insights into the evolution of these important signaling proteins:

  • Structural Conservation and Divergence:

    • Core structural elements (transmembrane domains, cyclic nucleotide binding domains) are conserved across species, suggesting fundamental importance to channel function

    • Specific amino acid differences in key regions (e.g., pore domain) correlate with functional differences in ion selectivity and divalent cation interactions

    • Insertions/deletions (such as the 12 uncharged residues N-terminal to the S4 segment in Drosophila) may represent adaptations to species-specific signaling requirements

  • Genomic Organization Patterns:

    • Drosophila possesses a single CNG channel gene compared to multiple genes in vertebrates

    • Conservation of exon-intron boundaries provides clues about evolutionary constraints on protein domains

    • Gene duplication and specialization events in vertebrate lineage likely allowed for tissue-specific adaptations of channel properties

  • Functional Adaptation:

    • Distinct sensitivity to cyclic nucleotides (Drosophila CNG channel is ~50-fold more sensitive to cGMP than cAMP)

    • Different patterns of calcium permeability and blockage reflect adaptation to species-specific signaling needs

    • Diverse expression patterns across tissues suggest evolutionary divergence in physiological roles

These evolutionary insights may guide the development of targeted approaches for manipulating channel function in different species and provide context for understanding human channelopathies .

What are promising future research directions for understanding CNG channel function in neural circuits?

Several promising research directions may advance our understanding of CNG channel function in neural circuits:

  • Circuit-Level Analysis:

    • Optogenetic manipulation of specific neuronal populations expressing CNG channels

    • Calcium imaging in identified neurons during behavior to correlate CNG channel activity with circuit function

    • Computational modeling of neural circuits incorporating CNG channel properties

    • Connectomic analysis of neurons expressing CNG channels to map their circuit context

  • Cell-Type Specific Rescue Experiments:

    • Targeted expression of wild-type CNG channels in specific neuronal populations in CNG mutant backgrounds

    • Assessment of behavioral and electrophysiological phenotypes following cell-type specific rescue

    • Determination of critical periods for CNG channel function in circuit development

  • Integration with Neuromodulatory Systems:

    • Investigation of how neuromodulatory signals (which often act through cyclic nucleotides) influence CNG channel function

    • Analysis of CNG channel contributions to homeostatic plasticity mechanisms

    • Examination of interactions between CNG channels and other ion channels in shaping neuronal excitability

Future research may focus on elucidating the role of CNG channels not only in motor neurons but also in premotor neurons, interneurons, and central pattern generators that regulate rhythmic behaviors in Drosophila . These studies will provide deeper insights into how these channels contribute to neural circuit function and behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.