Recombinant Drosophila melanogaster Derlin-1 (Der-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Der-1; CG10908; Derlin-1; DER1-like protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Der-1
Target Protein Sequence
MDAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFV FPISSNTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFL MDTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIFHFSLASLVGIFVGHV YYFFKFQYSQDLGGTPLLETPQFLKRLVPDVSGGFGGFGLPPESRAPPRQATESPWGRGM TLGRN
Uniprot No.

Target Background

Function
Derlin-1 may participate in the degradation of specific misfolded endoplasmic reticulum (ER) luminal proteins. Additionally, it may be involved in endoplasmic reticulum stress-induced pre-emptive quality control, a mechanism that selectively reduces the translocation of newly synthesized proteins into the ER and redirects them to the cytosol for proteasomal degradation.
Database Links

KEGG: dme:Dmel_CG10908

STRING: 7227.FBpp0077489

UniGene: Dm.2301

Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Drosophila melanogaster Derlin-1 and what are its primary functions?

Drosophila Derlin-1 is an ER membrane protein that serves as a critical component of the ER-associated degradation (ERAD) pathway. It functions as a partner for TER94 (the fly homolog of VCP/p97) and participates in the retrotranslocation of misfolded proteins from the ER to the cytosol for degradation . Derlin-1 expression increases in response to ER stress, suggesting it plays a crucial role in maintaining ER homeostasis . Additionally, Derlin-1 restrains intestinal stem cell proliferation to maintain intestinal homeostasis in adult Drosophila .

How is Derlin-1 structured and how does it interact with TER94/VCP?

Drosophila Derlin-1 spans the ER membrane either four or six times, consistent with its proposed function as a channel for substrate passage through the ER membrane . It contains a C-terminal segment with similarity to the SHP box, which facilitates its direct association with TER94 . Pull-down assays demonstrated that while the N-terminal portion of Derlin-1 was incapable of binding to TER94, the C-terminal portion containing the SHP box was sufficient to bind both wild-type TER94 and the pathogenic TER94 A229E mutant . This binding was abolished when the SHP box was removed, confirming that this motif is essential for the direct association of Derlin-1 with TER94 .

How does Derlin-1 regulate pathogenic TER94/VCP mutants in IBMPFD models?

In IBMPFD (Inclusion body myopathy with Paget disease and frontotemporal dementia) models, specific mutations in the VCP gene cause muscle and neuron degeneration by depleting cellular ATP levels due to hyperactive ATPase activity . Overexpression of Derlin-1 inhibits the elevated ATPase activities of pathogenic TER94 mutants and suppresses the neurodegenerative defects .

Compared to controls, flies expressing the pathogenic TER94 A229E mutant exhibited a 25% reduction in cellular ATP levels, but co-expression of Derlin-1 with TER94 A229E restored ATP levels to normal . This suggests a therapeutic potential for targeting Derlin-1 in VCP-linked diseases, as Derlin-1 expression can suppress IBMPFD-like neurodegeneration by restoring normal cellular ATP levels through direct inhibition of the mutant's hyperactive ATPase activity .

What are the mechanisms by which Derlin-1 maintains tissue homeostasis?

Derlin-1 plays crucial roles in maintaining tissue homeostasis through several mechanisms:

  • Intestinal homeostasis: Derlin-1 and TER94/VCP/p97 restrain intestinal stem cell proliferation in adult Drosophila . Depleting either component results in increased stem cell proliferation and disruption of midgut homeostasis through elevated ROS levels and activated JNK signaling . Removal of ROS or inhibition of JNK signaling almost completely suppresses this increased stem cell proliferation .

  • Neural stem cell regulation: The Derlin-1-Stat5b axis regulates adult hippocampal neurogenesis . Derlin-1 deficiency in neural stem cells leads to excessive proliferation and impaired transition from active to quiescent states . This eventually results in premature depletion of the neural stem cell pool in aged animals, leading to reduced neurogenesis, impaired cognitive function, and increased seizure susceptibility .

How does imbalance between Derlin-1 and TER94 affect cellular function?

The balance between Derlin-1 and TER94 levels is critical for cellular health. Research shows that overexpression of Derlin-1 alone impairs ERAD, activates the Unfolded Protein Response (UPR), and causes apoptosis, mimicking the effects of severe ER stress . Interestingly, these Derlin-1 overexpression defects are suppressed by increased TER94 expression .

This suggests that while Derlin-1 and TER94 work cooperatively in the ER stress response, their imbalance can be detrimental to cells. Under normal conditions, they collaborate to maintain ER homeostasis through ERAD, but disruption of their balance may be a mechanism for eliminating cells suffering from prolonged ER stress . This balance may have therapeutic implications for conditions involving ER stress and protein quality control defects.

What is the role of Derlin-1 in neurological function and disease?

Derlin-1 plays significant roles in neurological function:

  • Seizure susceptibility: Derlin-1 deficiency in neural stem cells increases seizure susceptibility in response to kainic acid administration . Derlin-1-deficient mice exhibit higher seizure scores compared to control mice, suggesting that appropriate Derlin-1-mediated localization of newly generated neurons is important for reducing seizure susceptibility .

  • Cognitive function: Derlin-1 is required for maintaining the neural stem cell pool in the aged brain and ensuring adequate neurogenesis throughout life . Derlin-1-deficient mice show impaired performance in the novel location recognition test, indicating deficits in hippocampus-dependent spatial discrimination ability .

  • Neurodegeneration: In IBMPFD models, Derlin-1 overexpression suppresses the neurodegenerative defects caused by pathogenic TER94/VCP mutants . This suggests potential therapeutic applications for modulating Derlin-1 expression in neurodegenerative disorders linked to VCP mutations.

What are effective approaches for expressing and purifying recombinant Drosophila Derlin-1?

Based on published research, GST-fusion proteins provide an effective approach for working with recombinant Drosophila Derlin-1 . The recommended methodology includes:

  • Construct design: Clone full-length Derlin-1 or specific domains (e.g., the C-terminal portion containing the SHP box) into a GST expression vector.

  • Expression system: Transform the construct into an E. coli expression strain for protein production.

  • Purification: Purify the GST-Derlin-1 fusion protein using glutathione-agarose beads, with subsequent elution using reduced glutathione or tag cleavage if necessary.

  • Functional verification: Verify the functionality of purified Derlin-1 through binding assays with TER94, as the C-terminal portion containing the SHP box should bind to both wild-type and mutant TER94 .

When designing constructs, it's important to note that the C-terminal portion of Derlin-1 containing the SHP box is sufficient for interaction with TER94, which might be useful for experiments focused on this specific interaction .

How can researchers effectively study Derlin-1 and TER94 interactions?

Several methodological approaches can be employed to study Derlin-1 and TER94 interactions:

  • Pull-down assays: Use GST-Derlin-1 fusion proteins to pull down TER94 from fly extracts . This approach has confirmed that the C-terminal portion of Derlin-1 containing the SHP box is sufficient for binding to both wild-type TER94 and pathogenic TER94 mutants .

  • ATPase activity assays: Measure TER94 ATPase activity in the presence or absence of Derlin-1 to assess functional interactions . This is particularly relevant for studying how Derlin-1 inhibits the elevated ATPase activities of pathogenic TER94 mutants.

  • Cellular ATP level measurements: Quantify cellular ATP levels as an indirect indicator of TER94 ATPase activity and its modulation by Derlin-1 . In published studies, flies expressing pathogenic TER94 A229E exhibited a 25% reduction in cellular ATP levels, which was restored by co-expression of Derlin-1 .

  • Co-localization studies: Use fluorescently tagged Derlin-1 and TER94 to study their co-localization under various conditions, including ER stress .

What genetic models are available for studying Derlin-1 function?

Several genetic models have been developed for studying Derlin-1 function:

  • Overexpression models: Transgenic flies carrying UAS-Derlin-1 constructs allow for tissue-specific overexpression when combined with appropriate GAL4 drivers . These models have demonstrated that Derlin-1 overexpression can suppress the neurodegenerative defects caused by pathogenic TER94 mutants .

  • Disease models: Flies expressing pathogenic TER94 mutants (such as TER94 A229E) serve as models for IBMPFD . These models exhibit neurodegeneration and reduced cellular ATP levels, providing a system to study how Derlin-1 modifies disease phenotypes.

  • Knockout/knockdown models: Conditional knockout mice (e.g., NesCre Derl1) have been used to study Derlin-1 function in neural stem cells . Similar approaches in Drosophila, using RNAi or CRISPR-Cas9, would be valuable for tissue-specific studies of Derlin-1 loss-of-function.

  • Reporter systems: Models incorporating UPR reporters like Xbp1-eGFP can be used to monitor ER stress responses in the context of Derlin-1 manipulation .

How can researchers assess Derlin-1's role in ER stress response?

Several methodological approaches can be used to assess Derlin-1's role in ER stress:

  • Expression analysis: Monitor Derlin-1 mRNA and protein levels using RT-PCR and Western blotting following treatment with ER stress inducers like DTT or cold shock .

  • UPR marker analysis: Measure the expression of UPR markers such as BiP (an ER chaperone) to assess UPR activation in response to Derlin-1 manipulation .

  • Reporter systems: Use reporter systems like Xbp1-eGFP to visualize UPR activation in vivo .

  • ER localization studies: Examine co-localization of Derlin-1 with ER markers (e.g., KDEL-eGFP) under normal and stress conditions .

  • ERAD efficiency assays: Assess ERAD efficiency by measuring the degradation rate of known ERAD substrates in the presence or absence of Derlin-1.

  • Apoptosis assays: Evaluate the pro-apoptotic function of Derlin-1 under severe ER stress conditions using appropriate cell death markers .

What experimental approaches can evaluate the impact of Derlin-1 on stem cell dynamics?

Based on published research, several approaches can be used to study how Derlin-1 affects stem cell dynamics:

  • In vivo proliferation assays: Use BrdU incorporation to quantify neural stem cell or intestinal stem cell proliferation in Derlin-1-deficient or overexpressing animals .

  • Quiescence transition assays: Investigate the rate at which activated stem cells return to the quiescent state in vivo by following BrdU-labeled stem cells over time .

  • In vitro culture systems: Utilize adult hippocampal NSC cultures treated with factors like bFGF (for proliferation) or diazepam/BMP4 (for quiescence induction) to study Derlin-1's role in state transitions .

  • ROS and JNK signaling analysis: Measure ROS levels and JNK activation in Derlin-1-deficient stem cells, and use ROS scavengers or JNK inhibitors to determine their contribution to the observed phenotypes .

  • Functional assessments: Evaluate the functional consequences of Derlin-1-mediated stem cell dysregulation using behavioral tests (e.g., novel location recognition test for cognitive function) or challenge paradigms (e.g., kainic acid administration for seizure susceptibility) .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.