Recombinant Drosophila melanogaster DnaJ homolog subfamily C member 25 homolog (CG7872)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CG7872; DnaJ homolog subfamily C member 25 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG7872
Target Protein Sequence
MRTHGLRLVLLALLPTMALGLLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHP DLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYDYMLDNPDAYYAHYYRYYRRRVAPK VDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYRNQALEIARDEIQEKIQKKGK NRMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIICPYTILSFIVWHAQW FWRYTVMKQPYGREQKLYLIRRHLGMGQHQFEAQEDKLIEEYLHLKLWKRENFVAWKAEQ EEEMKKKLAENPRYKAYRRYMKNHGPGRITFED
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG7872

STRING: 7227.FBpp0073862

UniGene: Dm.7770

Protein Families
DNAJC25 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.