Recombinant Drosophila melanogaster DnaJ-like protein 60 (DnaJ-60)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DnaJ-60; DmJ60; DnaJ60; CG12240; DnaJ-like protein 60
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-217
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
DnaJ-60
Target Protein Sequence
MLRLCLPTRAGYVRNFSNDKPRKPETHYEVLNIRNDCSTREVRNAFVQLSKLYHPDVKSN AACPERTARFVQISEAYKTLIKPERRRDYDDSLLWQPSRSDRSPVGETVNPGQAWDVRPN YDPNPGPYYGIRGLKRVSNWQVAVVLMALGFVGALFGFTSVRSSFKLSRQIQDEISAEAN SHHAAVVADAQKYGNEEQVRRMVDRMSRSPFNQSSAK
Uniprot No.

Target Background

Function

This protein may play a significant role in spermatogenesis and/or within the male reproductive tract.

Database Links

KEGG: dme:Dmel_CG42567

STRING: 7227.FBpp0290487

UniGene: Dm.39362

Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Highly expressed in testis and ejaculatory bulb.

Q&A

How is the expression of DnaJ-60 regulated in different tissues and developmental stages?

Northern blot analysis has revealed that DnaJ-60 exhibits a highly tissue-specific expression pattern. The 0.75-kb transcript is:

  • Weakly expressed in embryos, larvae, and adult females

  • Intensively expressed in adult males

In situ hybridization studies have further refined this pattern, showing that DnaJ-60 is:

  • Highly expressed in male testes and the ejaculatory bulb

  • Expressed at undetectable levels in ovaries

This expression pattern strongly suggests that DnaJ-60 plays a specific role in male reproductive physiology, potentially contributing to spermatogenesis or functions within the male genital tract. Unlike some heat-inducible chaperones, DnaJ-60 does not appear to be significantly upregulated under heat stress conditions, suggesting its function may be more specialized compared to canonical stress-responsive chaperones.

Where is the DnaJ-60 gene located in the Drosophila genome and what is its genomic organization?

The DnaJ-60 gene is located at position 60C on the right arm of the second chromosome of Drosophila melanogaster . Its chromosomal location is the origin of its name (DnaJ-60). The gene encodes a transcript of approximately 0.75 kb .

In the context of the broader DnaJ gene family in Drosophila, it is worth noting that the Drosophila genome contains 39 DnaJ domain protein genes . These genes are distributed across all chromosomes, with DnaJ-60 being one of several DnaJ family members located on chromosome 2.

While specific information about the intron-exon structure of DnaJ-60 is not explicitly provided in the search results, research on other DnaJ family genes in various organisms shows variability in genomic organization, with some members having no introns and others having multiple introns .

What is known about the interaction between DnaJ-60 and Hsp70 chaperones in protein folding mechanisms?

The interaction between DnaJ proteins and Hsp70 is a cornerstone of cellular protein quality control. While specific data on DnaJ-60's interaction with Hsp70 is limited in the provided search results, we can infer mechanisms based on studies of other DnaJ proteins.

Key Interaction Mechanisms:

  • J-domain Interaction: The J-domain of DnaJ proteins contains a conserved His-Pro-Asp (HPD) motif that is critical for stimulating the ATPase activity of Hsp70 . DnaJ-60 possesses this domain, suggesting similar functionality.

  • Substrate Delivery: DnaJ proteins typically bind to unfolded or misfolded proteins and deliver them to Hsp70 for refolding .

  • Conformational Stabilization: Some DnaJ proteins, like the one studied in relation to TorI, can bind to folded substrates and induce conformational stabilization . DnaJ-60 may have similar capabilities.

Experimental Evidence from DnaJ Family:
Studies with other DnaJ proteins have shown that:

  • Both the J-domain and adjacent glycine/phenylalanine-rich region are required for interactions with Hsp70 and stimulation of its ATPase activity

  • The binding of DnaJ to Hsp70 occurs at a site distinct from the peptide binding site

  • DnaJ proteins can work with Hsp70 to prevent protein aggregation, assist in refolding of denatured proteins, and aid in protein degradation

To experimentally characterize DnaJ-60's specific interaction with Hsp70:

  • In vitro ATPase stimulation assays using purified recombinant proteins

  • Co-immunoprecipitation studies in Drosophila cells

  • Yeast two-hybrid or mammalian two-hybrid assays

  • FRET-based interaction studies in live cells

How might the membrane-spanning domain of DnaJ-60 influence its subcellular localization and functional specificity?

The presence of a centrally located hydrophobic segment in DnaJ-60 suggests a membrane-spanning domain , which is a distinctive feature compared to many cytosolic DnaJ proteins. This structural element likely has significant implications for its function and localization.

Potential Functional Implications:

  • Subcellular Compartmentalization:

    • The membrane domain may anchor DnaJ-60 to specific cellular membranes (e.g., ER, mitochondria, or specialized membrane domains in testes)

    • This localization could restrict its chaperone activity to membrane-proximal proteins or membrane protein complexes

  • Specialized Functions in Male Reproductive Tissues:

    • Given its high expression in testes , DnaJ-60 may be localized to membranes specific to sperm development

    • Potential roles in membrane remodeling during spermatogenesis

    • May assist in folding or quality control of membrane proteins essential for sperm function

  • Protein Complex Formation:

    • The membrane domain could facilitate interaction with other membrane-associated proteins

    • May form part of a larger quality control complex at specific membrane sites

Experimental Approaches to Study Membrane Domain Function:

ApproachMethodologyExpected Outcome
Subcellular fractionationDifferential centrifugation followed by Western blottingDetermination of membrane association
Fluorescence microscopyGFP fusion constructs with wild-type and membrane domain mutantsVisualization of subcellular localization
Domain swap experimentsReplace membrane domain with heterologous sequencesTest functional complementation
Liposome binding assaysIncubation of purified protein with artificial liposomesMeasure membrane affinity and specificity
Site-directed mutagenesisAlter key residues in the hydrophobic segmentIdentify critical residues for membrane association

Creating a series of deletion or substitution mutants affecting the membrane domain would be particularly informative for understanding its role in DnaJ-60 function.

What are the optimal conditions for expression and purification of recombinant DnaJ-60 for structural and functional studies?

Based on approaches used for similar DnaJ proteins and considering the unique features of DnaJ-60, the following protocol is recommended:

Expression System Selection:

Expression SystemAdvantagesConsiderations for DnaJ-60
E. coli BL21(DE3)High yield, economicalMay require optimization for membrane-spanning domain
Insect cell systemBetter for eukaryotic proteinsHigher cost but may provide better folding
Cell-free systemAvoids toxicity issuesUseful if protein is toxic to expression host

Recommended Expression Protocol:

  • Vector Construction:

    • Clone DnaJ-60 into pET system (e.g., pET28a) with N-terminal His-tag

    • Consider fusion partners (MBP, SUMO) to enhance solubility

  • Purification Strategy:

    • Nickel affinity chromatography (similar to protocol in )

    • Ion exchange chromatography (given high pI of 10.5)

    • Size exclusion chromatography for final polishing

  • Special Considerations:

    • The membrane-spanning domain may cause aggregation; consider:

      • Using mild detergents (0.03% DDM or 0.5% CHAPS)

      • Testing truncated constructs lacking the membrane domain

      • Employing amphipols or nanodiscs for structural studies

For functional studies, verify protein activity using ATPase stimulation assays with Drosophila Hsp70 proteins.

What genetic tools and experimental designs are most effective for studying DnaJ-60 function in Drosophila?

Several genetic approaches and experimental designs can be employed to study DnaJ-60 function in Drosophila:

Genetic Tools for DnaJ-60 Analysis:

  • Loss-of-Function Approaches:

    • CRISPR/Cas9-mediated gene knockout

    • P-element-based mutagenesis (similar to approach in )

    • RNAi knockdown using UAS-RNAi lines with tissue-specific Gal4 drivers

    • Imprecise P-element excision for generating deletion alleles

  • Gain-of-Function Approaches:

    • UAS-DnaJ-60 transgenic lines for overexpression studies

    • Tissue-specific expression using the Gal4/UAS system

    • Heat-shock inducible promoter constructs

  • Protein Tagging Strategies:

    • Endogenous tagging via CRISPR/Cas9

    • HA, FLAG or GFP fusion constructs for localization and immunoprecipitation studies

Experimental Designs for Functional Characterization:

Experimental ApproachMethodologyExpected Insights
Male fertility assaysCompare fertility in DnaJ-60 mutants vs. controlsTest role in male reproductive biology
Genetic interaction studiesCross with neurodegenerative disease modelsAssess impact on protein aggregation
Stress response assaysExpose to heat shock, oxidative stressDetermine role in stress protection
Tissue-specific knockdownUse multiple Gal4 driversIdentify critical tissues for function
Developmental analysisStudy impact throughout lifecycleDefine temporal requirements

Specific Experimental Design Example:

To investigate DnaJ-60's role in protein aggregation diseases (like HD):

  • Generate UAS-DnaJ-60 transgenic flies

  • Cross with flies expressing mutant HTT (e.g., HTT103Q)

  • Analyze:

    • Protein aggregation using fluorescence microscopy

    • Behavioral phenotypes (climbing assay, lifespan)

    • Cellular toxicity markers

This approach mirrors successful studies with other DnaJ proteins that were identified as suppressors of neurodegenerative phenotypes .

How can the chaperone activity of DnaJ-60 be measured in vitro and in vivo?

In Vitro Assays for DnaJ-60 Chaperone Activity:

  • ATPase Stimulation Assay:

    • Measures ability of DnaJ-60 to stimulate Hsp70's ATPase activity

  • Protein Aggregation Prevention Assay:

    • Measures ability to prevent aggregation of model substrates

  • Protein Refolding Assay:

    • Assesses ability to assist Hsp70 in refolding denatured proteins

In Vivo Assays for DnaJ-60 Function:

  • Aggregation Suppression in Cell Culture:

    • Transfect S2 cells with aggregation-prone proteins (HTT103Q)

    • Co-express DnaJ-60 or control

    • Quantify aggregates by fluorescence microscopy or filter trap assay

  • In Vivo Suppression of Neurodegeneration:

    • Express aggregation-prone proteins (HTT103Q) in fly eye using GMR-Gal4

    • Co-express DnaJ-60 or control

    • Assess eye degeneration phenotype and quantify using established scoring systems

  • Thermotolerance Assay:

    • Generate flies overexpressing or lacking DnaJ-60

    • Expose to heat stress (37°C for 30-60 minutes)

    • Measure survival and recovery time

    • Analyze heat-induced protein aggregation by biochemical methods

Data Analysis Approach:
For quantitative comparison of DnaJ-60 with other chaperones, calculate:

  • EC50 values for aggregation prevention

  • Fold-enhancement of Hsp70 ATPase activity

  • Refolding rate constants

  • Percentage rescue in in vivo assays

These data would provide a comprehensive functional profile of DnaJ-60's chaperone activity compared to other DnaJ family members.

What bioinformatic approaches can be used to identify potential client proteins and interacting partners of DnaJ-60?

Multiple computational and bioinformatic strategies can be employed to predict and prioritize potential DnaJ-60 client proteins:

Sequence-Based Prediction Methods:

  • Motif Analysis:

    • Analyze known DnaJ binding motifs in the Drosophila proteome

    • Hydrophobic amino acid clusters are often recognized by DnaJ proteins

    • Tools: MEME, GLAM2, SLiMSearch

  • Comparative Genomics:

    • Identify proteins co-evolving with DnaJ-60 across insect species

    • Analyze correlation of presence/absence patterns

    • Tools: EggNOG, OrthoDB, OrthoMCL

Structure-Based Prediction Methods:

  • Protein-Protein Docking:

    • Generate homology model of DnaJ-60 based on known DnaJ structures

    • Perform molecular docking with potential clients

    • Tools: HADDOCK, ClusPro, ZDOCK

  • Binding Site Prediction:

    • Identify potential substrate binding surfaces on DnaJ-60

    • Map conservation onto structural model

    • Tools: ConSurf, SPPIDER, meta-PPISP

Network-Based Approaches:

  • Co-expression Analysis:

    • Identify genes co-expressed with DnaJ-60 in testis

    • Mining RNA-seq data across developmental stages

    • Tools: WGCNA, GeneMANIA

  • Functional Association Networks:

    • Analyze protein interaction databases for DnaJ family interactors

    • Extend to DnaJ-60 based on domain conservation

    • Resources: STRING, BioGRID, FlyBase

Data Integration Framework:

For prioritizing candidate interactions, integrate multiple lines of evidence using a scoring system:

Evidence TypeWeightScoring Criteria
Co-expression0.3Pearson correlation coefficient
Domain complementarity0.2Presence of known binding motifs
Structural compatibility0.3Docking score
Evolutionary conservation0.2Conservation score across species

Validation Strategy:
After prioritizing candidates, experimental validation should follow:

  • Co-immunoprecipitation assays

  • Yeast two-hybrid screening

  • Proximity labeling approaches (BioID, APEX)

  • In vitro binding assays with purified components

These approaches would significantly narrow down the potential interactome of DnaJ-60, particularly focusing on its specialized role in male reproductive tissues.

How has DnaJ-60 evolved across Drosophila species and other insects, and what does this tell us about its function?

Evolutionary analysis of DnaJ-60 can provide valuable insights into its functional significance and specialization across species. While the search results don't provide direct comparative analyses of DnaJ-60 across species, we can outline approaches to conduct such analyses:

Phylogenetic Analysis Framework:

  • Sequence Retrieval and Alignment:

    • Identify DnaJ-60 orthologs in multiple Drosophila species and other insects

    • Perform multiple sequence alignment using MUSCLE or MAFFT

    • Focus on conservation of key domains:

      • J-domain with HPD motif

      • Membrane-spanning domain

      • C-terminal region

  • Evolutionary Rate Analysis:

    • Calculate dN/dS ratios to identify selection pressures

    • Compare evolutionary rates of different domains

    • Hypothesis: Membrane domain may show lineage-specific adaptations

  • Domain Architecture Comparison:

    • Analyze conservation of domain organization across species

    • Identify species-specific insertions/deletions

    • Map changes to 3D structural models

Expected Evolutionary Patterns and Functional Implications:

Based on what is known about DnaJ-60's expression in male reproductive tissues, several hypotheses can be formulated:

Evolutionary PatternFunctional Implication
High conservation of J-domainCore chaperone function is maintained
Variable membrane domainAdaptation to different subcellular compartments
Rapid evolution in C-terminusSpecies-specific substrate interactions
Male-specific expression conservationConserved role in spermatogenesis
Lineage-specific duplicationsPotential functional specialization

Correlation with Reproductive Biology:

Given DnaJ-60's expression in male reproductive tissues, evolutionary patterns may correlate with species-specific aspects of reproduction:

  • Species with different mating systems

  • Species with varying sperm competition pressures

  • Species with different spermatogenesis processes

Methodological Approach:

  • Generate a comprehensive phylogenetic tree of DnaJ-60 across species

  • Map expression patterns onto the tree where data is available

  • Perform statistical tests for correlation between sequence evolution and reproductive traits

  • Identify convergent evolution patterns that might indicate functional constraints

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.