Recombinant Drosophila melanogaster Dopamine receptor 2 (DopR2)

Shipped with Ice Packs
In Stock

Description

Autoreceptor Regulation

DopR2 acts as a presynaptic autoreceptor, modulating dopamine release through negative feedback. Key findings:

  • Agonists (e.g., bromocriptine) reduce evoked dopamine release by 40-60% in larval CNS preparations .

  • Antagonists (e.g., flupenthixol) increase dopamine release by 25-35%, confirming autoreceptor functionality .

Behavioral Modulation

  • Courtship Behavior: Adult males with BBB-specific DopR2 knockdown exhibit reduced courtship initiation and mating success. Rescue experiments confirm receptor necessity in Subperineurial Glia (SPG) cells .

  • Learning and Memory: DopR2 in mushroom body neurons regulates aversive/appetitive olfactory learning. RNAi-mediated knockdown impairs associative conditioning in larvae .

In Vitro Studies

Recombinant DopR2 enables:

  • Radioligand binding assays to screen agonists/antagonists.

  • Structural studies of GPCR signaling mechanisms in heterologous systems (e.g., HEK293) .

In Vivo Models

  • Gene Silencing: Tissue-specific RNAi (e.g., TH-Gal4 for dopaminergic neurons) reveals roles in development and behavior .

  • Pharmacological Testing: Flupenthixol treatment mimics DopR2 loss-of-function phenotypes, including developmental arrest .

Research Limitations and Future Directions

  • Isoform Diversity: Eight splice variants exist, but functional differences remain uncharacterized .

  • Glial vs. Neuronal Roles: BBB-specific functions (e.g., courtship regulation) require further mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Dop1R2; DAMB; DopR2; DopR99B; CG18741; Dopamine receptor 2; Dopamine 1-like receptor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-539
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Dop1R2
Target Protein Sequence
MVDDNGSSPEVEGAEGAGAPLLALLRVDGLNQTQTRSPSPSFFGSYNISEDVYFYFNGLP TSTELVLNATTSATSATLSPAMVATGGGGTTTPEPDLSEFLEALPNDRVGLLAFLFLFSF ATVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTD WCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAI SFPAIVWWRAARDGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQT RSLKIGTKQVLMASGELQLTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHS HHHHHNHGGGTTTSTPEEPDDEPLSALHNNGLARHRHMGKNFSLSRKLAKFAKEKKAAKT LGIVMGVFIICWLPFFVVNLLSGFCIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRD FRRAFVRLLCMCCPRKIRRKYQPTMRSKSQRFATRRCYSTCSLHGIQHVRHNSCEQTYI
Uniprot No.

Target Background

Function
Dopamine receptor 2 (DopR2) is a G protein-coupled receptor that mediates dopamine signaling by activating adenylyl cyclase and inducing calcium signaling. Functionally, it belongs to the D1-like dopamine receptor group. Its role in initiating biochemical cascades underlying olfactory learning makes it a significant research target.
Gene References Into Functions
  1. Damb receptor uniquely activates Gq to mobilize Ca(2+) signaling with greater efficiency and dopamine sensitivity. PMID: 29166600
  2. Dop1R2 plays a role in repressing genes that regulate metamorphosis. PMID: 27184815
  3. DAMB protein activation state influences oxidative stress susceptibility in Drosophila, providing insight into paraquat neurotoxicity. PMID: 25158689
  4. DD2R gene expression is higher in young females than mature females, primarily localized in the fat body, but absent in ovarian follicular cells. PMID: 25486781
Database Links

KEGG: dme:Dmel_CG18741

STRING: 7227.FBpp0303325

UniGene: Dm.2334

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in both central and peripheral nervous systems.

Q&A

What is Drosophila melanogaster Dopamine receptor 2 (DopR2) and how does it function?

DopR2 (also referred to as Dop2R or D2R in the literature) is a D2-like dopamine receptor in Drosophila that plays crucial roles in various physiological and behavioral processes. Similar to mammalian D2 receptors, DopR2 is a G protein-coupled receptor that mediates dopamine signaling. DopR2 has been shown to regulate locomotor activity and plays significant roles in learning and memory processes .

At the molecular level, DopR2 functions in opposition to the D1-like receptor Dop1R1, with both receptors reported to oppositely regulate intracellular cAMP levels . This opposing regulation is critical for fine-tuning dopaminergic responses across different neural circuits. DopR2 signaling may work through multiple downstream pathways, including G-protein dependent signaling and potentially β-Arrestin mediated pathways that are independent of traditional G-protein cascades .

Where is DopR2 expressed in Drosophila and what are its distribution patterns?

DopR2 shows diverse expression patterns throughout the Drosophila nervous system and some peripheral tissues. Notably, DopR2 is expressed in:

  • The blood-brain barrier (BBB), specifically in the glial Subperineurial Glia (SPG) cells, where it plays a role in regulating male courtship behavior

  • Both presynaptic and postsynaptic sites in multiple neuronal cell types, with a greater degree of presynaptic localization compared to Dop1R1

  • Dopamine neurons themselves, where it functions as an autoreceptor to provide feedback regulation

  • Specific clusters of dopamine neurons including the protocerebral anterior medial (PAM) and posterior lateral 1 (PPL1) clusters, with expression levels that can change in response to physiological states like starvation

  • Neuronal and peripheral tissues including portions of the gut and malpighian tubules

This expression pattern suggests that DopR2 has multiple functions depending on its cellular context, allowing for sophisticated modulation of dopaminergic signaling across different systems.

How does DopR2 compare functionally to DopR1?

DopR2 and DopR1 (Dop1R1) represent the two major classes of dopamine receptors in Drosophila, and they display significant functional differences:

  • Signaling mechanisms: DopR2 and Dop1R1 oppositely regulate intracellular cAMP levels, allowing for bidirectional control of downstream signaling pathways .

  • Subcellular localization: Both receptors are found at presynaptic and postsynaptic sites, but DopR2 shows a greater degree of presynaptic localization than Dop1R1, suggesting differential roles in synaptic modulation .

  • Behavioral roles:

    • Dop1R1 is involved in odor-sugar memory but doesn't affect sucrose consumption

    • DopR2 plays a key role in increased sucrose sensitivity and consumption, particularly in flies raised on sugar-lacking diets

    • Both receptors can work in parallel for memory formation and updating, as well as shaping behavioral responses

  • Expression regulation: The two receptors show differential regulation under physiological states. For instance, starvation induces bidirectional modulation of their expression in specific dopamine neuron clusters like PAM and PPL1 .

This complementary yet distinct functionality allows for sophisticated control of dopaminergic signaling across different neural circuits and behaviors.

What role does DopR2 play in Drosophila courtship behavior?

DopR2 has a significant role in regulating male courtship behavior in Drosophila, particularly through its expression in the blood-brain barrier (BBB). Research has demonstrated:

  • DopR2 mutants (both hypomorphic and null mutants) show reduced courtship behavior without any reduction in general activity levels

  • Knockdown of DopR2 specifically in the adult BBB leads to reduced male courtship behavior

  • The courtship defects in DopR2 mutants can be rescued by expressing the wildtype receptor specifically in the BBB of mature males

  • This BBB-specific function is distinct from potential leakiness in the barrier itself, as DopR2 mutants maintain an intact BBB when tested with standard dye injection assays

Additionally, dopamine signaling more broadly plays roles in courtship through:

  • Activation of various dopaminergic neuron clusters (protocerebral anterior lateral, posterior lateral 2ab and 2c, PPM 2, and 3) that drive courtship behavior and increase copulation duration in males

  • Downstream signaling through Dop1R2-expressing P1 interneurons that directly contribute to male sex drive

These findings highlight a novel mechanism where glial cells in the BBB, through DopR2 signaling, can influence complex behaviors like courtship, suggesting important interactions between the BBB and neural circuits controlling behavior.

How does DopR2 function in reward processing and reward-related behaviors?

DopR2 plays crucial roles in Drosophila reward circuits and reward-related behaviors:

  • Food reward processing: DopR2 is key for increased sucrose sensitivity and consumption in Drosophila raised on diets lacking sugar . This suggests its role in adaptive feeding behaviors based on nutritional state.

  • Protein/amino acid preference: While dopaminergic neurons broadly contribute to protein preference, DopR2 specifically may be involved in the reject of food lacking essential amino acids. DL1 dopamine neurons are necessary and sufficient for amino acid preference expression .

  • Reward circuit integration: DopR2 functions within a broader network of monoaminergic neurotransmitters (including dopamine, serotonin, and octopamine) that collectively encode different aspects of reward . For example:

    • Dopamine (acting through receptors including DopR2) is central to sensing, encoding, responding, and predicting reward

    • Serotonin and octopamine carry environmental information that influences dopamine circuit activity

    • Together these systems form modulatory circuits that can scale with reward intensity and adapt to experience, internal state, and environmental context

  • Memory formation: DopR2 participates in the formation and updating of reward-associated memories, which is crucial for adaptive behaviors in response to rewarding stimuli .

These functions highlight DopR2's importance in adaptive behaviors that help Drosophila respond appropriately to beneficial environmental stimuli like food resources.

What is known about the subcellular localization of DopR2 and its significance?

Recent research has revealed important details about DopR2's subcellular localization that provide insights into its function:

  • Presynaptic and postsynaptic presence: DopR2 is located at both presynaptic and postsynaptic sites in multiple cell types within the mushroom body circuit, a brain region critical for learning and memory .

  • Preferential presynaptic enrichment: Quantitative analysis has shown that DopR2 displays a greater degree of presynaptic localization compared to Dop1R1, suggesting specific roles in presynaptic modulation .

  • Autoreceptor function: DopR2's presynaptic localization in dopamine neurons themselves indicates it functions as an autoreceptor, providing feedback regulation of dopamine release .

  • State-dependent regulation: Intriguingly, DopR2 expression shows bidirectional modulation in response to starvation in specific dopamine neuron clusters:

    • In the protocerebral anterior medial (PAM) cluster, which is associated with reward signaling

    • In the posterior lateral 1 (PPL1) cluster, which is often associated with aversive signaling

    • This starvation-dependent regulation suggests DopR2's role in appetitive behaviors and adaptive responses to nutritional state

  • Co-localization with opposing receptor: DopR2 is often co-expressed with Dop1R1, which has opposing effects on cAMP signaling, suggesting sophisticated spatial and conditional regulation of dopamine responses .

This detailed subcellular mapping reveals that DopR2 positioning within neurons is precisely regulated and has important functional consequences for neural circuit function.

What genetic tools are available for studying DopR2 function in Drosophila?

Researchers have developed several genetic tools to investigate DopR2 function:

  • Mutant lines:

    • Dop2R^f06521: A hypomorphic mutant resulting from Bac element insertion in an intron

    • D2R delta1: A null mutant generated by recombination of two Bac inserts that deletes the gene

    • These mutants show reduced courtship behavior and serve as valuable tools for studying DopR2 function

  • RNAi constructs:

    • D2R-RNAi constructs that target sequences common to all isoforms enable tissue and temporal-specific knockdown of DopR2

    • When expressed widely in the nervous system, D2R-RNAi causes decreased locomotion, a phenotype that can be rescued with the D2R agonist bromocriptine

  • Gal4 driver lines:

    • Tissue-specific Gal4 lines (e.g., Mdr-Gal4 for SPG cells in the BBB) allow targeted expression or knockdown in specific cell types

    • Temporal control can be achieved using temperature-sensitive Gal80^ts which allows for adult-specific manipulation

  • Protein visualization techniques:

    • Split-GFP tagging of receptor proteins enables cell-type-specific visualization of endogenous DopR2

    • This technique has been valuable for quantifying subcellular localization patterns

  • Optogenetic tools:

    • Optimized optogenetically controlled versions of dopamine receptors (optoDopRs) that can replace or mimic dopamine receptor functionality in vivo

    • These tools enable study of DA-dependent function and behavior with high spatiotemporal precision and specificity

These genetic tools provide researchers with sophisticated approaches to manipulate and visualize DopR2 in specific tissues, at specific developmental stages, and with precise temporal control.

How can researchers effectively measure DopR2 activity in vivo?

Measuring DopR2 activity in vivo poses challenges but several approaches have proven effective:

  • Behavioral assays:

    • Courtship assays: Quantifying courtship index in DopR2 mutants or knockdown flies provides an indirect measure of receptor function

    • Locomotion assays: DopR2 regulates locomotor activity, making this a useful behavioral readout

    • Learning and memory paradigms: DopR2 plays roles in these processes, so appropriate assays can measure its function

    • Feeding assays: Measuring sucrose consumption and sensitivity can evaluate DopR2's role in reward-related behaviors

  • Pharmacological approaches:

    • Use of D2R agonists like bromocriptine to rescue phenotypes caused by DopR2 knockdown or mutation

    • Application of antagonists to block receptor function in specific contexts

  • Molecular and cellular readouts:

    • cAMP measurements: Since DopR2 regulates cAMP levels, FRET-based cAMP sensors can provide readouts of receptor activity

    • Calcium imaging: For pathways where DopR2 activation leads to calcium changes, calcium indicators can be used

    • Phosphorylation of downstream targets: Measuring the phosphorylation state of proteins in pathways like Akt, PP2A, and GSK3β can indicate DopR2 activity through β-Arrestin signaling

  • Optogenetic approaches:

    • Light-dependent G protein activation using optoDopRs allows precise temporal control and measurement of receptor activity

    • These tools can be used to study specific aspects of DopR2 function in various DA-dependent behaviors including locomotion, arousal, learning, and feeding

  • Expression analysis:

    • Monitoring changes in DopR2 expression levels under different physiological conditions (e.g., starvation) provides insights into receptor regulation

Combining these approaches provides a comprehensive picture of DopR2 activity and function in different contexts and cell types.

What are the challenges in studying DopR2 signaling specificity?

Researchers face several challenges when investigating DopR2 signaling specificity:

  • Multiple signaling pathways:

    • DopR2 can signal through multiple downstream pathways, including G-protein and potentially β-Arrestin mediated pathways

    • Distinguishing between these pathways and their specific contributions to different behaviors is challenging

  • Receptor isoforms:

    • Different isoforms of DopR2 exist, including "short forms" that may function as autoreceptors

    • These isoforms may have different signaling properties and subcellular localizations

  • Co-expression with opposing receptors:

    • DopR2 is often co-expressed with Dop1R1, which has opposing effects on cAMP signaling

    • Understanding how neurons integrate these opposing signals is complex

  • Context-dependent signaling:

    • DopR2 function varies based on cell type and physiological state

    • For example, starvation induces bidirectional modulation of receptor expression in different dopamine neuron clusters

  • Developmental vs. acute effects:

    • Distinguishing between developmental roles of DopR2 and its acute functions in mature circuits requires careful experimental design

    • Conditional manipulation strategies are needed to separate these effects

  • Cross-talk with other neurotransmitter systems:

    • DopR2 functions within broader networks involving serotonin, octopamine, and glutamate signaling

    • This cross-talk complicates interpretation of receptor-specific effects

To address these challenges, researchers employ comprehensive approaches combining genetic tools, pharmacology, behavioral assays, and advanced imaging techniques. The development of optoDopRs with improved signaling specificity and light-dependent G protein activation represents an important advance in overcoming some of these challenges .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.