Recombinant Drosophila melanogaster E3 ubiquitin-protein ligase HRD1 (sip3)

Shipped with Ice Packs
In Stock

Description

Definition and Nomenclature

Recombinant Drosophila melanogaster E3 ubiquitin-protein ligase HRD1 (sip3) is a recombinant protein derived from the sip3 gene, encoding an ER-associated E3 ubiquitin ligase critical for endoplasmic reticulum-associated degradation (ERAD). It is also known as Synoviolin or septin-interacting protein 3. This protein facilitates the ubiquitination of misfolded or short-lived ER proteins, targeting them for proteasomal degradation .

ER Stress Response

HRD1 (sip3) is central to ER quality control. Under ER stress, it interacts with:

  • XBP1: Spliced XBP1 regulates chaperones like HSC3 (GRP78 homolog). sip3 RNAi elevates Xbp1s (spliced XBP1) and PERK but suppresses Drs and Mtk (immune-response genes) .

  • HSC3: Genetic knockdown of HSC3 upregulates sip3 expression, suggesting a compensatory feedback loop .

Innate Immunity

ERAD-mediated protein degradation by sip3 is critical for Toll pathway activation. RNAi of sip3 or ERAD components (Hrd3, Derlin-1, Herp) reduces antimicrobial peptide induction (Drs, Mtk) and increases susceptibility to bacterial infections (E. faecalis, S. aureus) .

Genetic Interactions

Interacting GeneInteraction TypeFunctional Impact
MANFGenetic interactionsip3 overexpression exacerbates MANF RNAi phenotypes
HSC3Compensatory regulationHSC3 knockdown upregulates sip3
XBP1ER stress signalingXBP1 knockdown reduces sip3 expression
PERKUPR activationPERK knockdown elevates sip3 mRNA

Applications in Research

ApplicationDetails
Recombinant Protein StudiesUsed to study ERAD mechanism, substrate specificity, and ubiquitination kinetics .
Immune Pathway AnalysisRNAi-mediated silencing links ERAD to Toll pathway activation and antimicrobial defense .
ER Stress Model SystemsOverexpression or knockdown models test ER stress adaptation and apoptosis .

Functional Validation

  • ER Stress Induction: Thapsigargin (TG) or tunicamycin (TM) treatment upregulates sip3 mRNA in Drosophila S2 cells .

  • p53 Regulation: Recombinant sip3 sequesters p53 in the cytoplasm, promoting its degradation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special format requests. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
sip3; Syno; CG1937; E3 ubiquitin-protein ligase HRD1; RING-type E3 ubiquitin transferase HRD1; Septin-interacting protein 3; Synoviolin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
16-626
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
sip3
Target Protein Sequence
VIGFAYYQKQQFYPAVVYITKSNASMGVIYIQFFVIVFMFGKLLSKIFLGTLRAAEFEHL LERFWYALTETCLAFTVFRDDFNPRFVALFTVLLFLKSFHWLAEERVDFMERSPVLGWLF HIRVGSLLTVLGILDYVLLIHAYNSTLVRGPTVQLVFGFEYAILLTVIASTAIKYVLHAA EMRTDTPWENKAVFLLYTELVIGLIKVVLYILFVVIMAKIYALPMFVFRPMFFTIRNFRK ALNDVIMSRRAIRNMNTLYPDATPEELRQSDNICIICREDMVNHSKKLPCGHIFHTTCLR SWFQRQQTCPTCRLNILRTPTVNSTAMPRQGDEAVAAAAGNPIPAAAGVQPAGGVPPPAP TAVVDGNQARADVNVAGGQALPPNFADLFGDASGLPNGLPNLAGLQIPPPPVMPMISPFM IPPHFGYLTPLPPPPIPQDLTNFTDEELRAMEGLQRDHIVQRLKLLQNINLMLDSAGIMM SQYQSLSARLQLTAVTPATAVNGSADSSVYDMPSTSATAMAQLETHQVTPTAAASSASPT MPAEKVTIEDLGADADEDDIPSTATEAVSIPNSDADFEENSSELGELRKRRLKFLEERNK SAATNERTTAE
Uniprot No.

Target Background

Function
Recombinant Drosophila melanogaster E3 ubiquitin-protein ligase HRD1 (sip3) acts as an E3 ubiquitin-protein ligase. It specifically accepts ubiquitin from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. This protein is a component of the endoplasmic reticulum quality control (ERQC) system, also known as ER-associated degradation (ERAD), involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. It also promotes the degradation of normal but naturally short-lived proteins. HRD1 protects cells from ER stress-induced apoptosis. It sequesters p53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological function in transcription, cell cycle regulation, and apoptosis.
Database Links

KEGG: dme:Dmel_CG1937

STRING: 7227.FBpp0303146

UniGene: Dm.1395

Protein Families
HRD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Drosophila melanogaster E3 ubiquitin-protein ligase HRD1 (sip3)?

Drosophila melanogaster E3 ubiquitin-protein ligase HRD1, also known as sip3, is a critical component of the endoplasmic reticulum-associated degradation (ERAD) pathway. It functions as an E3 ubiquitin ligase that plays a central role in ERAD of membrane proteins (ERAD-M), particularly in the degradation of misfolded proteins like rhodopsin . The full-length mature protein spans amino acids 16-626 and contains conserved domains critical for its ubiquitin ligase activity . HRD1 is part of the SEL1L-HRD1 protein complex, which represents the most conserved branch of ERAD, essential for clearing misfolded proteins in the ER . In Drosophila models, HRD1 has been shown to reduce ER stress and alleviate photoreceptor cell loss when overexpressed .

What physiological roles does HRD1 (sip3) play in Drosophila melanogaster?

HRD1 in Drosophila melanogaster plays several crucial physiological roles:

  • Protein quality control: HRD1 is a central component of the ERAD pathway that removes misfolded proteins from the ER, maintaining cellular proteostasis .

  • Suppression of retinal degeneration: HRD1 overexpression reduces ER stress induced by mutant rhodopsin (Rh1 G69D) and alleviates photoreceptor cell loss in fly models of autosomal dominant retinitis pigmentosa (adRP) .

  • Rhodopsin homeostasis: Despite its importance in protein quality control, flies lacking HRD1 exhibit normal rhodopsin and photoreceptor cell function, suggesting functional redundancy with other E3 ligases in maintaining rhodopsin homeostasis .

  • ER stress response modulation: HRD1 helps suppress ER stress by facilitating the degradation of misfolded proteins, as demonstrated by its ability to reduce xbp1 splicing (a marker of ER stress) when overexpressed in models of Rh1 misexpression .

These functions highlight HRD1's importance in maintaining cellular health, particularly in photoreceptor cells that are sensitive to protein misfolding stress .

How can recombinant Drosophila HRD1 (sip3) be optimally expressed and purified?

For optimal expression and purification of recombinant Drosophila melanogaster E3 ubiquitin-protein ligase HRD1 (sip3), the following methodological approach is recommended:

Expression System:

  • E. coli is the preferred expression system for recombinant production

  • The full-length mature protein (amino acids 16-626) should be fused to an N-terminal His tag for efficient purification

Purification Protocol:

  • Express the protein in E. coli using a suitable expression vector

  • Lyse cells under native or denaturing conditions depending on experimental requirements

  • Purify using nickel affinity chromatography, leveraging the His tag

  • Dialyze against an appropriate buffer system (typically Tris/PBS-based buffer, pH 8.0)

  • Add 6% trehalose as a stabilizing agent

  • Lyophilize the purified protein for long-term storage

Storage and Reconstitution:

  • Store the lyophilized powder at -20°C/-80°C

  • Prior to use, briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for aliquots intended for long-term storage

  • Avoid repeated freeze-thaw cycles; working aliquots can be stored at 4°C for up to one week

This methodology ensures high purity (>90% as determined by SDS-PAGE) and functional integrity of the recombinant protein for research applications .

What experimental approaches can be used to study HRD1's role in ERAD using Drosophila models?

Several experimental approaches have been successfully employed to study HRD1's role in ERAD using Drosophila models:

1. Genetic Manipulation Approaches:

  • Overexpression studies: Using GAL4-UAS system to overexpress wild-type or mutant forms of HRD1 in specific tissues, particularly the eye

  • Knockdown experiments: Employing inverted repeat transgenic constructs to produce dsRNA targeting HRD1, allowing tissue-specific silencing

  • CRISPR/Cas9-mediated genome editing: Generating specific mutations or deletions in the HRD1 gene

2. Protein Interaction Analysis:

  • Co-immunoprecipitation assays: To study interactions between HRD1 and potential substrates or partners like SEL1L

  • Proximity-dependent biotin identification (BioID): For identifying novel HRD1 interactors in vivo

  • Yeast two-hybrid screening: For initial identification of protein-protein interactions

3. Functional Assays:

  • Ubiquitination assays: To measure HRD1's E3 ligase activity against putative substrates like mutant rhodopsin (Rh1 G69D)

  • ER stress reporters: Using xbp1-EGFP as a reporter to detect UPR activation in response to ER stress

  • Immunohistochemistry: To monitor rhodopsin levels and localization in photoreceptor cells

4. Retinal Degeneration Assessment:

  • Optical neutralization technique: For examining ommatidial structure

  • Electron microscopy: To assess ultrastructural changes in photoreceptor cells

  • Electrophysiological methods: To measure photoreceptor function via electroretinograms

These methodologies have revealed that HRD1 overexpression can suppress ER stress caused by misfolded rhodopsin, while HRD1 knockdown increases Rh1 protein levels in Drosophila models of adRP .

How does HRD1 function in Drosophila models of retinal degeneration?

In Drosophila models of retinal degeneration, HRD1 functions as a protective factor through several mechanisms:

  • Clearance of misfolded rhodopsin: HRD1 plays a central role in removing mutant rhodopsin (Rh1 G69D) from the ER, thereby reducing ER stress and preventing photoreceptor cell death . This function is particularly important in models of autosomal dominant retinitis pigmentosa (adRP).

  • Regulation of ER stress responses: Overexpression of HRD1 has been shown to reduce UPR activation in response to misfolded rhodopsin expression, as measured by decreased xbp1 splicing . This suppression of ER stress helps maintain photoreceptor cell viability.

  • Substrate-specific ubiquitination: HRD1 facilitates the ubiquitination of mutant rhodopsin, marking it for degradation through the proteasome pathway . This targeted degradation prevents the accumulation of toxic protein aggregates.

  • Functional redundancy with other E3 ligases: Despite its role in rhodopsin degradation, flies lacking HRD1 show normal rhodopsin levels and photoreceptor function, suggesting that other E3 ubiquitin ligases (like SORDD1/2) can compensate for its loss .

What is the relationship between HRD1 (sip3) and other E3 ubiquitin ligases in Drosophila ERAD?

The relationship between HRD1 (sip3) and other E3 ubiquitin ligases in Drosophila ERAD is characterized by both functional overlap and substrate specificity:

  • Functional redundancy: The observation that flies lacking HRD1 have normal rhodopsin and photoreceptor function suggests functional redundancy with other E3 ubiquitin ligases . This redundancy ensures robust protein quality control even when one component is compromised.

  • Complementary ERAD E3 ligases: Research has identified two novel E3 ubiquitin ligases, SORDD1 and SORDD2, that effectively suppress Rh1 G69D-induced photoreceptor dysfunction and retinal degeneration . These ligases can ubiquitylate Rh1 G69D in vivo, similar to HRD1.

  • Substrate specificity: Despite functional overlap, different E3 ligases may show preference for specific substrates or structural features of misfolded proteins. For example, HRD1 has been implicated in the degradation of membrane proteins (ERAD-M), while other E3 ligases may preferentially target luminal or cytosolic domains .

  • Complex formation differences: While HRD1 forms a complex with SEL1L, other E3 ligases may associate with different cofactors. These distinct complex compositions likely contribute to substrate recognition specificity and regulatory differences .

  • Evolutionary conservation: The HRD1-SEL1L complex represents the most conserved branch of ERAD, while other E3 ligases may show different patterns of evolutionary conservation, suggesting specialized functions that emerged during evolution .

This complex network of E3 ubiquitin ligases ensures robust ERAD function and provides multiple pathways for the removal of diverse misfolded proteins, offering potential redundancy and resilience to the protein quality control system.

How can HRD1 (sip3) be manipulated to suppress retinal degeneration in experimental models?

Several experimental approaches have demonstrated successful manipulation of HRD1 (sip3) to suppress retinal degeneration in Drosophila models:

1. Genetic Overexpression Strategies:

  • Tissue-specific overexpression: Using the GAL4-UAS system to overexpress HRD1 specifically in photoreceptor cells has been shown to reduce ER stress and alleviate photoreceptor cell loss in flies expressing the Rh1 G69D mutation

  • Temporal control: Employing temperature-sensitive GAL80 inhibitor to achieve temporal control of HRD1 expression, allowing researchers to determine critical intervention windows

2. Enhancement of HRD1-SEL1L Complex Formation:

  • SEL1L co-expression: Co-expressing SEL1L with HRD1 enhances complex formation and stability, potentially improving ERAD efficiency

  • Targeted mutagenesis: Engineering HRD1 variants with enhanced substrate recognition or improved catalytic activity while maintaining the critical Y30 residue important for SEL1L interaction

3. Manipulation of Regulatory Factors:

  • Derlin-1 modulation: Co-expression of Derlin-1 (CG10908), a candidate retrotranslocation channel component, with HRD1 may enhance ERAD efficiency

  • Herp regulation: Controlling levels of Herp (CG14536), an associated protein that impacts HRD1 function

4. Combination Approaches:

  • Multi-E3 ligase approach: Simultaneous overexpression of HRD1 with SORDD1/2 to achieve more robust suppression of retinal degeneration

  • UPR modulation plus ERAD enhancement: Combining HRD1 overexpression with controlled activation of adaptive UPR branches to achieve synergistic protection

Experimental results demonstrate that manipulating HRD1 levels can significantly impact disease progression in models of retinal degeneration. For instance, overexpression of HRD1 in ninaE G69D/+ flies reduced ER stress (as measured by xbp1 splicing) and preserved photoreceptor integrity . These findings suggest that enhancing ERAD function through HRD1 manipulation represents a promising therapeutic strategy for conformational diseases affecting the retina.

What are common challenges when working with recombinant Drosophila HRD1 and how can they be addressed?

Researchers working with recombinant Drosophila melanogaster E3 ubiquitin-protein ligase HRD1 (sip3) often encounter several challenges. Here are the most common issues and recommended solutions:

1. Protein Solubility and Aggregation Issues:

  • Challenge: As a membrane protein, HRD1 contains hydrophobic regions that can cause aggregation

  • Solution: Express as a fusion protein with solubility-enhancing tags; use mild detergents during purification; incorporate 6% trehalose in storage buffer; optimize pH to 8.0

2. Maintaining Enzymatic Activity:

  • Challenge: Loss of ubiquitin ligase activity during purification or storage

  • Solution: Minimize freeze-thaw cycles; store working aliquots at 4°C for up to one week; add glycerol (5-50%) for long-term storage; include proper cofactors during activity assays

3. Protein-Protein Interaction Preservation:

  • Challenge: Disruption of native interactions with partners like SEL1L

  • Solution: Co-express with interaction partners; perform careful buffer optimization; use gentle purification methods; consider including stabilizing agents that maintain aromatic-aromatic interactions

4. Expression System Limitations:

  • Challenge: Low yield or improper folding in bacterial expression systems

  • Solution: Consider insect cell or mammalian expression systems for better post-translational modifications and folding; optimize codon usage for E. coli if bacterial expression is required

5. Functional Assay Development:

  • Challenge: Difficulties in developing robust in vitro ubiquitination assays

  • Solution: Include appropriate E1 and E2 enzymes; ensure the presence of all necessary cofactors; optimize reaction conditions; consider using fluorescently labeled substrates for easier detection

These methodological considerations can significantly improve the quality and utility of recombinant Drosophila HRD1 preparations for research applications.

How does mutating key residues affect HRD1 function in experimental systems?

Mutagenesis studies have revealed several key residues that significantly impact HRD1 function in experimental systems:

1. HRD1 Y30 Residue:

  • This highly conserved tyrosine residue (from Drosophila to humans, but not in yeast) is critical for SEL1L-HRD1 interaction

  • Mutations of HRD1 Y30 to Ala (A), Asp (D), or Lys (K) significantly disrupted the SEL1L-HRD1 interaction by 80-90%

  • Mutation to Phe (F) had a less severe effect, disrupting interaction by only 30%

  • The disruption of SEL1L-HRD1 interaction abolished the interaction of HRD1 with OS9, while having no impact on HRD1 interaction with FAM8A1

2. Catalytic RING Domain Residues:

  • Mutations in the RING domain abolish the E3 ubiquitin ligase activity of HRD1

  • In studies with SORDD1, mutation of the catalytic cysteine (C165S) prevented ubiquitination of Rh1 G69D-Myc

  • Similar mutations in HRD1's catalytic domain would be expected to eliminate its ability to ubiquitinate substrates

3. Transmembrane Domain Mutations:

  • Alterations in transmembrane domains can affect HRD1's ER localization and substrate access

  • Proper membrane integration is required for HRD1 to function effectively in ERAD

The following table summarizes the effects of key residue mutations on HRD1 function:

ResidueMutationEffect on Protein InteractionEffect on Enzymatic ActivityEffect on Substrate Recognition
Y30Y30A80-90% reduction in SEL1L bindingPresumed reductionLoss of OS9 interaction
Y30Y30D80-90% reduction in SEL1L bindingPresumed reductionLoss of OS9 interaction
Y30Y30K80-90% reduction in SEL1L bindingPresumed reductionLoss of OS9 interaction
Y30Y30F30% reduction in SEL1L bindingMinimal reductionPartial OS9 interaction
RING domain cysteinesC→SMinimal effect on bindingComplete lossPotential loss

These findings highlight the importance of specific residues in maintaining HRD1's functional interactions and enzymatic activity. Understanding these structure-function relationships is crucial for designing experiments to manipulate HRD1 activity in research contexts.

What are the emerging roles of HRD1 beyond canonical ERAD in Drosophila systems?

Recent research suggests HRD1 may have functions extending beyond its canonical role in ERAD. These emerging roles represent exciting areas for future investigation:

  • Development and differentiation: Given that disruption of SEL1L-HRD1 interaction in mammals leads to developmental abnormalities including microcephaly and developmental delay , HRD1 may play critical roles in Drosophila development and neuronal differentiation that remain to be fully explored.

  • Stress response coordination: HRD1 appears to integrate various cellular stress responses beyond ER stress, potentially serving as a hub for coordinating proteostasis under different stress conditions .

  • Cross-talk with autophagy: Emerging evidence from mammalian systems suggests potential cross-talk between ERAD and autophagy pathways. The role of HRD1 in mediating this cross-talk in Drosophila warrants investigation.

  • Tissue-specific functions: The finding that HRD1 is particularly important in retinal homeostasis suggests it may have specialized functions in other tissues that could be uncovered through tissue-specific experimental approaches.

  • Non-degradative ubiquitination: While HRD1's canonical role involves K48-linked ubiquitination leading to proteasomal degradation, it may also catalyze other types of ubiquitin linkages that could mediate signaling rather than degradation.

Future research using tissue-specific knockdown/overexpression combined with proteomic approaches will be essential to uncover these non-canonical roles of HRD1 in Drosophila systems.

How can insights from Drosophila HRD1 research be translated to therapeutic approaches for human diseases?

Insights from Drosophila HRD1 research offer several promising avenues for translational applications in human disease therapeutics:

  • Retinal degenerative diseases: The demonstration that HRD1 overexpression can suppress retinal degeneration in Drosophila models of adRP suggests that enhancing ERAD activity could be a therapeutic strategy for human retinitis pigmentosa and related conditions . Gene therapy approaches targeting HRD1 or its regulators could potentially slow disease progression.

  • Neurodegenerative disorders: Given the importance of protein quality control in neurons and the role of protein misfolding in conditions like Alzheimer's and Parkinson's diseases, insights from Drosophila HRD1 studies could inform strategies to enhance ERAD in neurodegenerative contexts.

  • Small molecule development: Understanding the structural basis of HRD1-SEL1L interaction and HRD1's catalytic mechanism in Drosophila provides templates for the development of small molecules that could enhance HRD1 activity or stabilize its interactions with partners like SEL1L .

  • Biomarker identification: Changes in HRD1 expression or activity could potentially serve as biomarkers for diseases involving ER stress and protein misfolding.

  • Combinatorial therapeutic approaches: The functional redundancy between HRD1 and other E3 ligases like SORDD1/2 in Drosophila suggests that targeting multiple ERAD components simultaneously might provide more robust therapeutic effects in human diseases.

These translational opportunities highlight the importance of basic research on Drosophila HRD1 for developing novel therapeutic strategies for human conformational diseases.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.