Recombinant Drosophila melanogaster FMRFamide receptor (FR)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant FR

The FR receptor (UniProt ID: Q9VZW5) is a G-protein-coupled receptor (GPCR) encoded by the CG2114 gene . Recombinant FR is produced in E. coli with an N-terminal His tag, enabling purification and detection . Key structural features include:

PropertyDetails
Amino Acid Sequence549 residues (Full-length)
Domains7 transmembrane helices characteristic of GPCRs
LigandsActivated by FMRFamide peptides (e.g., DPKQDFMRFamide)
Expression SystemE. coli

This recombinant form retains functional properties comparable to native FR, as confirmed by ligand-binding assays .

Functional Role in Drosophila Physiology

FR mediates myotropic and neuromodulatory effects via intracellular signaling pathways:

  • Muscle Contraction:

    • DPKQDFMRFamide induces Ca²⁺-dependent contractions in larval body wall muscles via FR .

    • RNAi knockdown of FR in muscle reduces peptide-induced contractions by 70–90% .

  • Flight Modulation:

    • FR in dopaminergic neurons regulates flight bout duration via IP₃ receptor (IP₃R)- and Ca²⁺/calmodulin-dependent kinase II (CaMKII)-dependent pathways .

    • FR knockout flies exhibit progressive flight deficits .

Key Studies

Study FocusMethodologyResult
Ligand SpecificityHeterologous receptor expression FR binds Drosophila FMRFamide-2 and -6 with high affinity (EC₅₀ ~10⁻⁸ M) .
RNAi KnockdownMuscle-specific FR silencing Peptide-induced muscle tonus reduced to 26% of wild-type levels .
CRISPR KnockoutΔFMRFaR mutants Flight durations reduced by >50% compared to controls .

Signaling Pathways

  • FR activation does not involve cAMP, cGMP, or PLCβ pathways in muscle .

  • Requires IP₃R-mediated Ca²⁺ release and CaMKII for presynaptic effects .

Applications in Neuroscience Research

Recombinant FR is used to:

  1. Decipher neuropeptide-GPCR interactions in vitro .

  2. Study calcium signaling dynamics in muscle and neuronal systems .

  3. Screen novel ligands for insect-specific pest control agents .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal storage, we advise storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
FMRFaR; FR; CG2114; FMRFamide receptor; DFR; DrmFMRFa-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-549
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
FR
Target Protein Sequence
MSGTAVARLLLRLELPSPGVMPPPPTDYDYGGPISDDEFLASAMATEGPTVRYDLFPQNN SQPTLQIVLNHTEVQTDLQYPHYEDLGLDPDPNWTRICEDVYNPLLENNRIEFWVCGVLI NIVGVLGILGNIISMIILSRPQMRSSINYLLTGLARCDTVLIITSILLFGIPSIYPYTGH FFGYYNYVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIY FIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVN YIIPFLTLAILNCLIYRQVKRANRERQRLSRSEKREIGLATMLLCVVIVFFMLNFLPLVL NISEAFYSTIDHKITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKRRLSRDQPDL IHYESSISNNGDGTLNHRSSGRFSRHGTQRSTTTTYLVATGGPGGGGCGGGGGNNSLNNV RLTQVSGSPGLVKIKRNRAPSPGPVVYFPAREMQRSASTTNSTTNNNTSIGYDWTLPDSK KLGHVSSGF
Uniprot No.

Target Background

Function
The FMRFamide receptor is a receptor for the FMRFamide peptides. It exhibits high affinity to FMRFamide and intrinsic FMRFamide-related peptides. By stimulating intracellular calcium signaling through the inositol 1,4,5-trisphosphate receptor (Itpr) in dopaminergic neurons, it may play a role in maintaining neuronal excitability and regulating flight bout duration.
Gene References Into Functions
  1. molecular cloning and expression of FMRFamide receptor PMID: 12218185
  2. The functionally active Drosophila melanogaster FMRFamide receptor (DrmFMRFa-R) was cloned and characterized. It is the first functionally active FMRFamide G protein-coupled receptor described in invertebrates to date. PMID: 12438685
Database Links

KEGG: dme:Dmel_CG2114

STRING: 7227.FBpp0072850

UniGene: Dm.14721

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in ovaries, heads and bodies. Expressed in dopaminergic neurons.

Q&A

What is the Drosophila melanogaster FMRFamide receptor?

The Drosophila melanogaster FMRFamide receptor (DrmFMRFa-R) is a G protein-coupled receptor (GPCR) that specifically responds to FMRFamide neuropeptides. It was the first functionally active FMRFamide receptor described in invertebrates . This receptor is structurally distinct from other known Drosophila neuropeptide receptors, though it shares some distant homology with mammalian thyroid-stimulating hormone-releasing hormone (TRH) receptors and certain Caenorhabditis elegans orphan receptors . The receptor plays critical roles in several physiological processes, most notably in the modulation of flight behavior through actions in dopaminergic neurons .

How was the Drosophila FMRFamide receptor gene initially identified and characterized?

The Drosophila FMRFamide receptor was identified through a systematic functional characterization of an orphan receptor (CG2114) from the Berkeley Drosophila Genome Project. Researchers cloned the full-length open reading frame from genomic DNA and employed a "reverse physiology" approach to identify its natural ligand .

Methodologically, the process involved:

  • Initial identification of the orphan receptor sequence in the Drosophila genome

  • Cloning of the full-length receptor coding sequence

  • Stable expression in Chinese hamster ovary (CHO) cells that also expressed human Gα16 protein and mitochondrially targeted aequorin

  • Screening the expressed receptor against peptide fractions purified from central nervous system tissue extracts

  • Identification of FMRFamide peptides as the natural ligands that activate the receptor in a dose-dependent manner

What signaling pathways are activated downstream of the FMRFamide receptor?

The FMRFamide receptor primarily triggers intracellular calcium signaling through the IP3 receptor (IP3R). Activation of this pathway helps maintain neuronal excitability in specific neuronal populations, particularly in dopaminergic neurons . The signaling cascade involves:

  • Receptor activation by FMRFamide peptides

  • Stimulation of the IP3 receptor, an intracellular Ca2+-release channel

  • Elevation of intracellular calcium levels

  • Activation of CaMKII (calcium/calmodulin-dependent protein kinase II)

  • Maintenance of neuronal membrane excitability

This pathway has been validated through genetic rescue experiments. Overexpression of downstream molecules, specifically the IP3R and CaMKII, significantly rescues flight deficits induced by knockdown of the FMRFamide receptor, confirming their role in the signaling cascade .

What peptides activate the Drosophila FMRFamide receptor and with what efficacy?

The Drosophila FMRFamide receptor is activated by several endogenous FMRFamide peptides with varying potencies. Specifically:

PeptideSequenceEC50Notes
Drosophila FMRFamidesVarious9 × 10^-10 MHighest potency
Drome-MSNot specified2 × 10^-7 M~200x less potent than FMRFamides
Drosophila short neuropeptide F-1Not specified9 × 10^-8 M~100x less potent than FMRFamides

Five specific Drosophila FMRFamide peptides have been identified as activating the receptor in a dose-dependent manner at nanomolar concentrations:

  • DPKQDFMRFamide

  • TPAEDFMRFamide

  • SDNFMRFamide

  • SPKQDFMRFamide

  • PDNFMRFamide

The receptor is not activated by benzethonium chloride, a feature shared with the two Drosophila myosuppressin receptors .

How can I express and functionally characterize the recombinant Drosophila FMRFamide receptor?

To express and functionally characterize the recombinant Drosophila FMRFamide receptor, implement the following methodological approach:

  • Cloning of receptor sequence:

    • Amplify the full-length open reading frame from Drosophila genomic DNA or cDNA

    • Clone the receptor sequence into an appropriate expression vector (e.g., pcDNA3)

  • Cell line selection and preparation:

    • Use Chinese hamster ovary (CHO) cells that stably express human Gα16 protein and mitochondrially targeted aequorin (mtAEQ)

    • Maintain cells in Ham's F12 medium supplemented with L-glutamine, FBS, and appropriate selection antibiotics

  • Stable transfection procedure:

    • Transfect the receptor construct using FuGENE 6 reagent or similar transfection methods

    • Select transformants with G418 (400 μg/ml) for approximately 2.5 weeks

    • Isolate individual clones for further characterization

    • Verify receptor expression by RT-PCR

  • Functional characterization:

    • Measure calcium mobilization in response to potential ligands using aequorin-based luminescence assays

    • Test dose-response relationships with known FMRFamide peptides

    • Determine EC50 values and rank-order potencies of ligands

This experimental system allows for robust expression and pharmacological characterization of the receptor, enabling studies of ligand specificity and signaling mechanisms.

What are the most effective methods to measure FMRFamide receptor activation?

Several complementary methods can be employed to measure activation of the FMRFamide receptor:

  • Calcium mobilization assays:

    • Aequorin-based luminescence assays in cells co-expressing mitochondrially targeted aequorin

    • Fluorescence-based calcium indicators (Fluo-4, Fura-2) to measure intracellular calcium dynamics

    • Real-time monitoring of calcium flux in receptor-expressing cells

  • Electrophysiological recordings:

    • Patch-clamp recordings to measure changes in neuronal excitability

    • Assessment of membrane potential changes in response to receptor activation

    • Investigation of ionic currents regulated by receptor signaling

  • Second messenger assays:

    • Measurement of IP3 production following receptor activation

    • Quantification of CaMKII phosphorylation state as a downstream readout

  • In vivo functional assays:

    • Targeted expression or knockdown of the receptor in specific neuronal populations

    • Behavioral readouts such as flight bout duration measurements

    • Neuronal activity monitoring using genetically encoded calcium or voltage indicators

Each method provides complementary information about receptor function, allowing for comprehensive characterization from molecular activation to physiological consequences.

How can I generate a CRISPR-Cas9 knockout of the FMRFamide receptor gene?

To generate a CRISPR-Cas9 knockout of the FMRFamide receptor gene, follow this methodological approach based on successful strategies used in Drosophila:

  • Design of guide RNAs (gRNAs):

    • Target sequences that, when cleaved, will remove most of the coding region

    • In previous successful knockouts, researchers targeted sites to remove nearly 1.5 kb of the 1.6 kb coding region of the FMRFamide receptor

    • Use Drosophila-optimized CRISPR design tools to minimize off-target effects

  • Construct preparation:

    • Clone the selected gRNAs into appropriate expression vectors

    • Prepare Cas9 expression constructs or obtain Cas9 protein for direct injection

  • Embryo microinjection:

    • Inject constructs into Drosophila embryos at the anterior pole during early development

    • Use established Drosophila embryo microinjection protocols

  • Screening and validation strategies:

    • Design PCR primer pairs spanning the targeted region

    • For the FMRFamide receptor, primers spanning the locus (e.g., 5'F+3'R) should amplify only a shortened genomic fragment (~400bp) in successful knockouts

    • Additional primer combinations (e.g., 5'F+5'R and 3'F+3'R) can help distinguish between homozygotes and heterozygotes

    • Confirm receptor loss by RT-PCR and/or Western blotting

This CRISPR-Cas9 approach has been successfully employed to generate complete FMRFamide receptor knockout lines, providing valuable tools for investigating receptor function in vivo.

What is the TARGET system and how can I use it for stage-specific FMRFamide receptor manipulation?

The TARGET (Temporal And Regional Gene Expression Targeting) system is a powerful technique for achieving temporal control of gene expression or knockdown in Drosophila. For stage-specific manipulation of the FMRFamide receptor, implement the following methodology:

  • System components:

    • The TARGET system employs a temperature-sensitive GAL80 element (TubGAL80^ts) that represses GAL4 activity at 18°C

    • At 29°C, GAL80^ts is inactivated, allowing GAL4 to drive expression of UAS-regulated transgenes

    • For FMRFamide receptor studies, combine TubGAL80^ts with a neuron-specific GAL4 driver and UAS-FMRFaR-RNAi

  • Experimental protocol for developmental studies:

    • Maintain flies at 18°C during development to prevent RNAi expression

    • Shift to 29°C at specific developmental stages to induce receptor knockdown

    • Return to 18°C to halt knockdown at subsequent stages

  • Adult-specific knockdown:

    • Rear flies at 18°C throughout development until eclosion

    • Transfer adult flies to 29°C to induce receptor knockdown only in mature neurons

    • This approach has been used to demonstrate that adult-specific FMRFamide receptor knockdown in dopaminergic neurons leads to progressive loss of sustained flight capability

  • Analysis of temporal requirements:

    • Assay relevant phenotypes (e.g., flight behavior) after stage-specific knockdown

    • Compare with developmental knockdown to distinguish developmental versus acute requirements

    • Document progressive changes in phenotype severity following adult-specific knockdown

The TARGET system has proven highly effective for dissecting the temporal requirements of FMRFamide receptor function, revealing distinct roles during development and in mature neurons.

What is the role of the FMRFamide receptor in Drosophila flight behavior?

The FMRFamide receptor plays a critical role in modulating flight behavior in Drosophila, particularly in controlling the duration of flight bouts. Research has revealed several key aspects of this function:

  • Receptor localization and cell types:

    • The receptor functions in central dopaminergic neurons to regulate flight

    • Expression in this specific neuronal subset is sufficient to maintain normal flight patterns

  • Behavioral phenotypes:

    • Knockdown or knockout of the FMRFamide receptor results in significantly shorter flight bout durations

    • Pan-neuronal knockdown with nSybGAL4 reduces flight durations from a median of approximately 600 seconds to less than 300 seconds

    • The receptor is particularly important for sustaining longer flight bouts

  • Progressive effects:

    • Adult-specific knockdown using the TARGET system leads to progressive deterioration of flight capability

    • This suggests an ongoing requirement for receptor signaling in mature neurons, rather than solely a developmental role

  • Ecological significance:

    • The ability to maintain longer flight bouts is hypothesized to enhance an individual's capacity to search for food sources and locate suitable egg-laying sites in natural conditions

These findings establish the FMRFamide receptor as a critical modulator of a complex motor behavior, providing insights into neuropeptidergic regulation of neural circuits controlling locomotion.

How does FMRFamide receptor signaling affect neuronal excitability?

FMRFamide receptor signaling maintains optimal neuronal excitability through a calcium-dependent signaling pathway:

  • Signaling mechanism:

    • Receptor activation triggers intracellular calcium release through the IP3 receptor (IP3R)

    • This calcium signaling activates calcium/calmodulin-dependent protein kinase II (CaMKII)

    • The pathway ultimately helps maintain appropriate membrane excitability in target neurons

  • Experimental evidence:

    • Genetic rescue experiments demonstrate that overexpression of the IP3R or CaMKII can significantly rescue flight deficits caused by FMRFamide receptor knockdown

    • This confirms these molecules as important downstream effectors in the signaling pathway

  • Neuronal populations affected:

    • The excitability effects are particularly important in specific dopaminergic neurons involved in flight control

    • The receptor's influence on neuronal excitability appears to be critical for sustained activity during prolonged flight bouts

  • Store-operated calcium entry (SOCE):

    • Initial genetic screening data suggests that store-operated calcium entry may also be involved in the downstream effects of receptor activation

    • This provides an additional mechanism for sustained calcium signaling following receptor activation

Understanding these excitability mechanisms provides insight into how neuropeptide signaling modulates neural circuit function over extended time periods, which is critical for sustained behaviors such as flight.

How conserved is the FMRFamide receptor system across Drosophila species?

The FMRFamide receptor system shows significant evolutionary conservation across Drosophila species, though with interesting species-specific variations:

This evolutionary conservation highlights the fundamental importance of these signaling systems in insect physiology and provides valuable comparative resources for identifying functionally critical domains.

What methodological approaches are most effective for comparing FMRFamide receptors across species?

For effective comparative analysis of FMRFamide receptors across species, implement the following methodological approaches:

  • Genomic sequence analysis:

    • Southern blot hybridization using conserved receptor probes

    • Whole genome sequencing and bioinformatic identification of receptor homologs

    • Phylogenetic tree construction to establish evolutionary relationships

  • Structural comparison techniques:

    • Analysis of amino acid sequence identity in full-length receptors

    • Focused comparison of transmembrane domains, which typically show higher conservation

    • Examination of gene structure, including intron positions and phasing, which can reveal ancient evolutionary relationships

    • For example, Drosophila myosuppressin receptors and their Anopheles homologs share two introns with identical phasings, strongly suggesting evolutionary relatedness

  • Functional characterization:

    • Heterologous expression of receptor homologs from different species

    • Comparative pharmacology with panels of peptide ligands

    • Cross-species activation studies to assess ligand conservation

  • Expression pattern comparison:

    • In situ hybridization to compare receptor expression patterns

    • Northern blot analysis to assess developmental and tissue-specific expression profiles

    • Immunohistochemistry using cross-reactive antibodies to visualize receptor localization

  • Tissue distribution profiling:

    • Northern blot analysis reveals that in D. melanogaster, FMRFamide receptor expression varies by developmental stage

    • The receptor is weakly expressed in embryos, larvae, and pupae

    • In adults, it shows strong expression in the head but is virtually absent in the thorax/abdomen

These comparative approaches provide valuable insights into both the evolution of neuropeptide signaling systems and the identification of functionally critical domains.

How can I investigate potential cross-reactivity between FMRFamide and related neuropeptide receptors?

Investigating cross-reactivity between FMRFamide and related neuropeptide receptors requires a multifaceted methodological approach:

  • Systematic pharmacological profiling:

    • Express individual receptors in heterologous systems (e.g., CHO cells)

    • Screen each receptor against a comprehensive panel of neuropeptides at various concentrations

    • Generate complete dose-response curves and calculate EC50 values for each ligand-receptor pair

    • This systematic approach has revealed that while the Drosophila FMRFamide receptor is most potently activated by FMRFamides (EC50 ~9×10^-10 M), it can also be activated by Drome-MS (EC50 ~2×10^-7 M) and Drosophila short neuropeptide F-1 (EC50 ~9×10^-8 M)

  • Competitive binding assays:

    • Use radiolabeled or fluorescently labeled peptides to measure direct binding

    • Perform competition assays with unlabeled peptides to determine binding affinities

    • Compare binding profiles across receptor subtypes

  • Signaling pathway analysis:

    • Compare the signaling cascades activated by different peptides at the same receptor

    • Investigate potential biased signaling where different ligands may preferentially activate distinct downstream pathways

  • Physiological relevance assessment:

    • Determine whether cross-reactivity occurs at physiologically relevant concentrations

    • For example, the EC50 value of the FMRFamide receptor for Drome-MS is only five times higher than the EC50 values for dedicated myosuppressin receptors, suggesting potential physiological cross-talk

    • Consider whether spatial and temporal expression patterns of receptors and peptides would allow for in vivo cross-reactivity

  • Structural basis investigation:

    • Identify receptor domains responsible for ligand selectivity through chimeric receptor approaches

    • Use site-directed mutagenesis to pinpoint specific amino acids critical for discriminating between related peptides

This methodical approach provides a comprehensive understanding of receptor selectivity and potential cross-talk in neuropeptide signaling systems.

What approaches can be used to investigate the developmental regulation of FMRFamide receptor expression?

Investigating the developmental regulation of FMRFamide receptor expression requires a comprehensive methodological toolkit spanning molecular, genetic, and imaging approaches:

  • Temporal expression profiling:

    • Quantitative RT-PCR at various developmental stages (embryo, larva, pupa, adult)

    • Northern blot analysis across developmental timepoints

    • Western blotting to measure protein levels

    • Previous studies have shown that FMRFamide receptor expression is weak in embryos, larvae, and pupae, but strong in adult fly heads

  • Spatial expression mapping:

    • In situ hybridization to visualize mRNA localization in tissue sections

    • Generation of reporter constructs with receptor promoter driving fluorescent protein expression

    • Immunohistochemistry using specific antibodies against the receptor

    • Cell-type specific analysis using single-cell RNA sequencing

  • Transcriptional regulation analysis:

    • Promoter dissection through reporter constructs with various promoter fragments

    • Identification of transcription factor binding sites through bioinformatic analysis

    • Chromatin immunoprecipitation (ChIP) to identify proteins binding to the receptor promoter

    • CRISPR-based manipulation of potential regulatory elements

  • Stage-specific functional perturbation:

    • Utilize the TARGET system for temporal control of receptor knockdown

    • Express receptor RNAi at specific developmental stages by temperature shifting

    • Analyze resulting phenotypes to determine stage-specific requirements

    • This approach has revealed distinct roles for the receptor during development versus in adult neurons

  • Epigenetic regulation investigation:

    • Analysis of DNA methylation patterns at the receptor locus

    • Histone modification profiling through ChIP-seq

    • Investigation of potential regulation by non-coding RNAs

This multifaceted approach provides comprehensive insights into the complex developmental regulation of FMRFamide receptor expression, establishing a foundation for understanding how neuropeptide signaling is coordinated throughout development.

What are the common challenges in expressing functional recombinant FMRFamide receptor and how can they be addressed?

Researchers frequently encounter several challenges when expressing functional recombinant FMRFamide receptor. Here are methodological solutions for each:

  • Low expression levels:

    • Optimize codon usage for the expression system being used

    • Test multiple expression vectors with different promoters

    • Include a Kozak consensus sequence for optimal translation initiation

    • Create stable cell lines rather than relying on transient transfection

    • Screen multiple clones to identify high-expressing lines

    • Use selection markers (e.g., G418 at 400 μg/ml) to maintain selection pressure

  • Poor membrane trafficking:

    • Add trafficking enhancement tags (e.g., signal peptides)

    • Co-express with chaperone proteins to aid folding

    • Reduce culture temperature (30-32°C) to allow more time for proper folding

    • Use cell lines with robust membrane protein expression machinery (e.g., CHO cells)

  • Ligand specificity verification:

    • Systematically test multiple known FMRFamide peptides (DPKQDFMRFamide, TPAEDFMRFamide, SDNFMRFamide, SPKQDFMRFamide, PDNFMRFamide)

    • Generate complete dose-response curves rather than testing single concentrations

    • Include positive controls (known receptor ligands) and negative controls

    • Test for cross-reactivity with related peptides at higher concentrations

  • Signaling detection challenges:

    • Co-express with promiscuous G proteins (e.g., Gα16) to couple to calcium mobilization

    • Include reporter systems like mitochondrially targeted aequorin (mtAEQ)

    • Use multiple complementary assay systems (calcium imaging, cAMP measurements)

    • Optimize cell density and assay conditions for maximum signal-to-noise ratio

  • Receptor desensitization:

    • Minimize exposure to serum components that might contain peptides

    • Use short incubation times for acute signaling assays

    • Consider arrestin co-expression studies to investigate desensitization mechanisms

    • Implement washout protocols for repeated stimulation experiments

Addressing these challenges with the described methodological approaches significantly improves the likelihood of successful functional expression and characterization of the recombinant FMRFamide receptor.

How can I optimize experimental design when studying FMRFamide receptor knockout phenotypes?

Optimizing experimental design for FMRFamide receptor knockout studies requires careful consideration of several methodological aspects:

  • Generation of appropriate controls:

    • Use multiple independent knockout lines to control for potential off-target effects

    • Include heterozygous animals to assess potential gene dosage effects

    • Generate precise rescue lines by re-expressing the receptor in specific tissues

    • For RNAi experiments, use control RNAi constructs targeting non-expressed genes

    • When using the GAL4-UAS system, control for potential GAL4 or UAS insertion effects

  • Phenotypic assay optimization:

    • Design assays with appropriate sensitivity and dynamic range

    • For flight behavior studies, record flight for extended periods (e.g., 15 minutes rather than 30 seconds) to detect deficits in sustained flight

    • Standardize testing conditions (time of day, temperature, humidity)

    • Use automated systems to minimize experimenter bias

    • Employ multiple complementary assays to comprehensively characterize phenotypes

  • Tissue and developmental specificity:

    • Implement the TARGET system for temporal control of knockdown

    • Compare phenotypes between developmental knockdown (throughout development at 29°C) and adult-specific knockdown

    • Use cell-type specific GAL4 drivers to pinpoint functionally relevant receptor populations

    • For flight studies, target dopaminergic neurons specifically, as they are critical for the receptor's effects on flight behavior

  • Molecular validation:

    • Confirm gene deletion by PCR using multiple primer pairs spanning the targeted locus

    • Verify absence of receptor expression by RT-PCR and/or Western blotting

    • Quantify knockdown efficiency in RNAi experiments

    • Document potential compensatory changes in related genes

  • Statistical considerations:

    • Determine appropriate sample sizes through power analysis

    • Apply suitable statistical tests based on data distribution

    • Account for multiple comparisons when analyzing complex datasets

    • Consider potential influences of genetic background and control for them

These methodological optimizations enhance the rigor and reproducibility of FMRFamide receptor knockout studies, ensuring that observed phenotypes are specifically attributable to receptor loss.

What are the emerging approaches for studying FMRFamide receptor interactions within neural circuits?

Several cutting-edge methodological approaches are emerging for studying FMRFamide receptor function within neural circuits:

  • Optogenetic and chemogenetic manipulation:

    • Combine cell-specific receptor knockdown with optogenetic activation/inhibition of the same or connected neurons

    • Implement DREADD (Designer Receptors Exclusively Activated by Designer Drugs) technology to manipulate specific neuronal populations

    • Use these approaches to dissect how receptor signaling modulates circuit function

  • Real-time imaging of receptor activation:

    • Develop and implement FRET-based sensors for receptor activation

    • Use genetically encoded calcium indicators (GECIs) to monitor activity in receptor-expressing neurons

    • Employ voltage indicators to measure membrane potential changes in response to peptide application

    • These approaches can be applied to both in vitro preparations and in vivo imaging in behaving animals

  • Single-cell transcriptomics and proteomics:

    • Identify the complete molecular profile of FMRFamide receptor-expressing neurons

    • Map receptor co-expression patterns with other receptors, ion channels, and signaling molecules

    • Characterize cell type-specific signaling networks downstream of receptor activation

  • Circuit mapping technologies:

    • Use trans-synaptic tracers to identify pre- and post-synaptic partners of receptor-expressing neurons

    • Implement expansion microscopy for nanoscale imaging of receptor localization

    • Apply connectomics approaches to place receptor-expressing neurons within broader circuit diagrams

  • Computational modeling:

    • Develop biophysically detailed models of how receptor activation modulates neuronal excitability

    • Simulate circuit-level effects of receptor modulation

    • Generate testable predictions about emergent circuit properties

These emerging approaches will provide unprecedented insights into how FMRFamide receptor signaling modulates neural circuit function to control complex behaviors such as flight.

How can FMRFamide receptor research inform our understanding of neuropeptide signaling systems across species?

FMRFamide receptor research provides a valuable model system for understanding broader principles of neuropeptide signaling across species:

  • Evolutionary principles of neuropeptide-receptor co-evolution:

    • Comparative analysis of FMRFamide receptors across Drosophila species and in other insects like Anopheles gambiae reveals patterns of evolutionary conservation and divergence

    • Studies show shared structural features and similar gene organization, with two shared introns between three different genes with identical intron phasings

    • These findings provide insights into how neuropeptide signaling systems evolve while maintaining functional specificity

  • Ligand-receptor selectivity mechanisms:

    • Research on FMRFamide receptor activation by various peptides (FMRFamides, Drome-MS, short neuropeptide F-1) illuminates principles of receptor promiscuity and specificity

    • Understanding the structural basis for these interaction patterns informs broader principles of GPCR-ligand recognition

  • Cross-talk between neuropeptide systems:

    • The FMRFamide receptor's ability to respond to multiple related peptides provides a model for studying signaling integration

    • The observation that the Drosophila FMRFamide receptor can potentially function as a third Drome-MS receptor under certain conditions demonstrates how neuropeptide systems can overlap functionally

  • Translation to mammalian systems:

    • Despite sequence divergence, many fundamental principles of neuropeptide GPCR signaling are conserved from insects to mammals

    • Mechanisms of receptor regulation, desensitization, and downstream signaling pathways often show remarkable conservation

    • Insights from the Drosophila system provide conceptual frameworks for understanding more complex mammalian neuropeptide systems

  • Technological developments with broad applicability:

    • Methodologies optimized for the FMRFamide receptor, such as the TARGET system for temporal control of expression, can be applied to studies of other neuropeptide systems

    • Novel screening approaches for receptor-ligand pairs can accelerate deorphanization of receptors across species

This research not only advances our understanding of insect neurobiology but also contributes to fundamental knowledge of neuropeptide signaling that transcends specific model systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.