Recombinant Drosophila melanogaster Frizzled-2 (fz2)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Drosophila melanogaster Frizzled-2 (Fz2) is a laboratory-generated version of the Fz2 receptor, a seven-pass transmembrane protein critical for Wingless (Wg)/Wnt signaling in Drosophila. Fz2 acts as a high-affinity receptor for Wg, mediating canonical Wnt/β-catenin signaling during embryonic development, wing imaginal disc patterning, and cell survival under low-ligand conditions . Unlike its homolog Frizzled-1 (Fz1), Fz2 is transcriptionally downregulated by Wg and exhibits functional redundancy with Fz1 in most developmental contexts .

Redundancy with Fz1

  • Fz2 and Fz1 are functionally redundant in Wg signaling: either receptor suffices for normal development .

  • Exception: Fz2 is indispensable under low-Wg conditions, where it provides a competitive survival advantage .

Signaling Pathways

  • Canonical Wnt/β-catenin pathway: Fz2 stabilizes β-catenin (Armadillo in Drosophila) by recruiting Dsh .

  • Non-canonical pathways: Unlike Fz1, Fz2 does not mediate planar cell polarity but may interact with calcium signaling modules .

Regulatory Mechanisms

  • Transcriptional feedback: Wg signaling downregulates fz2 expression, creating a gradient of receptor availability .

  • Subcellular localization: Apical membrane localization of Fz1 inhibits canonical signaling, whereas Fz2 localization enhances it .

Applications in Research

Recombinant Fz2 is widely used to study:

  • Ligand-receptor interactions: Fz2’s CRD binds Wg with ~9 nM affinity, making it ideal for biochemical assays .

  • Cell-based assays: Transfection of Fz2 into S2 cells restores Wg responsiveness, enabling in vitro studies of Wnt signaling .

  • Structural studies: Engineered Fz2 fragments (e.g., CRD-Fc fusions) facilitate crystallography and binding assays .

Table 2: Recombinant Fz2 Expression Systems

Expression SystemAdvantagesExample Use Case
YeastHigh yield; post-translational modificationsLigand binding assays
E. coliCost-effective; rapid productionStructural studies
BaculovirusEukaryotic folding; large-scale productionFunctional signaling assays

Key Research Findings

  • Genetic redundancy: Double mutants of fz and fz2 abolish Wg signaling, confirming their overlapping roles .

  • Affinity differences: Fz2 binds Wg with higher affinity than Fz1, explaining its dominance in long-range signaling .

  • Evolutionary conservation: Fz2 homologs in butterflies (V. cardui) mediate WntA signaling, highlighting conserved roles in patterning .

Future Directions

  • Mechanistic studies: Elucidate how Fz2’s C-tail regulates β-catenin stabilization versus calcium signaling.

  • Therapeutic potential: Explore Fz2’s role in diseases linked to Wnt dysregulation (e.g., cancer, neurodegeneration) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize developing the specified tag.
Synonyms
fz2; CG9739; Frizzled-2; dFz2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-694
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
fz2
Target Protein Sequence
DGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSF PNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCER ARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGS GSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLI FLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIA LWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDG LLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHL AAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAG FVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFED WIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLG APDRTGANQALIKQRPPIPHPYAGSGMGMPVGSAAGSLLATPYTQAGGASVASTSHHHLH HHVLKQPAASHV
Uniprot No.

Target Background

Function
Frizzled-2 (Fz2) serves as a receptor for Wnt proteins. Most frizzled receptors are linked to the beta-catenin canonical signaling pathway, which activates disheveled proteins, inhibits GSK-3 kinase, promotes nuclear accumulation of beta-catenin, and ultimately activates Wnt target genes. An alternative signaling pathway involving PKC and calcium fluxes has been observed for some family members, but its relationship to the canonical pathway remains unclear. PKC appears to be essential for Wnt-mediated inactivation of GSK-3 kinase, suggesting potential integration with the canonical pathway. Both pathways involve interactions with G-proteins. Fz2 plays a crucial role in coordinating the cytoskeletons of epidermal cells to produce a parallel arrangement of cuticular hairs and bristles.
Gene References Into Functions
  1. Maturation of a central brain flight circuit in Drosophila requires Fz2 and Ca2+ signaling. PMID: 25955970
  2. A study found that C-terminal fragments of the Wg receptor DFz2 accumulate in nuclear foci associated with large RNA granules located in the space between the inner and outer nuclear membranes. These granules are observed at inner membrane invaginations, are bounded by LamC, and can be seen leaving the nucleus. PMID: 22579286
  3. Subcellular Fz localization, mediated by its association with other membrane proteins, is a critical factor in regulating signaling specificity within the Wnt/Fz signaling pathways. PMID: 15252441
  4. Frizzled2 captures and internalizes ligands, while Arrow, and possibly downstream signaling, are essential for lysosomal targeting. PMID: 16291792
  5. DFz2 acts as an endocytic receptor for Wingless in the Drosophila wing. PMID: 16530179
  6. Data indicate that GRIP is essential for trafficking Frizzled-2 to the nucleus. PMID: 16682643

Show More

Hide All

Database Links

KEGG: dme:Dmel_CG9739

STRING: 7227.FBpp0303228

UniGene: Dm.2524

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Drosophila melanogaster Frizzled-2 and what is its primary function?

Frizzled-2 (Fz2) is a seven-pass transmembrane protein belonging to the Frizzled family of receptors in Drosophila melanogaster. Its primary function is to bind Wingless (Wg), a founding member of the Wnt family of secreted proteins, and transduce Wg signaling. Fz2 serves as one of the primary receptors for Wg in Drosophila, playing crucial roles in embryonic development and tissue patterning . The protein is predicted to enable Wnt receptor activity and Wnt-protein binding activity, acting upstream of or within several processes including the Wnt signaling pathway and calcium modulating pathway .

How does Frizzled-2 differ structurally and functionally from other Frizzled receptors in Drosophila?

Drosophila melanogaster has multiple Frizzled receptors with distinct functional roles:

Frizzled ReceptorPrimary FunctionSignaling PathwayKey Characteristics
Frizzled-1 (Fz1)Planar Cell PolarityWnt-independent Fz/PCP pathwaySole receptor necessary for Wnt-independent PCP
Frizzled-2 (Fz2)Wg signal transductionCanonical Wnt and non-canonical Ca²⁺ pathwaysMaintains long-range activation of Wnt pathway
Frizzled-3 (Fz3)Wg signal attenuationAntagonistic to WntFunctions as a decoy receptor that attenuates Wg signaling
Frizzled-4 (Fz4)Limited role in wingsUnknown in Drosophila wingsNo known function in Drosophila wings

What phenotypes are associated with Frizzled-2 loss-of-function in Drosophila melanogaster?

In the context of central brain development, knockdown or inhibition of Fz2/Ca²⁺ signaling during maturation of the flight circuit reduces Tyrosine Hydroxylase (TH) expression in the protocerebral anterior medial (PAM) dopaminergic neurons. This reduction affects flight maintenance, resulting in flies that rarely remain airborne for more than 20 seconds, compared to normal flies that can typically fly for over 700 seconds .

How can recombinant Fz2 be utilized to study non-canonical Wnt signaling pathways?

Methodological Approach:
Recombinant Fz2 can be employed to investigate non-canonical Wnt signaling through several experimental strategies:

  • Calcium imaging assays: Since Fz2 activates downstream Ca²⁺ signaling through non-canonical mechanisms, recombinant Fz2 can be used in conjunction with calcium indicators to visualize and quantify intracellular calcium transients in response to Wnt stimulation .

  • Protein interaction studies: Utilizing tagged recombinant Fz2 in pull-down assays to identify novel binding partners in the non-canonical pathway, particularly focusing on connections between Fz2, Go proteins, and calcium signaling components.

  • Domain-specific mutant analysis: Generating recombinant Fz2 proteins with mutations in specific domains to determine which regions are essential for non-canonical versus canonical signaling activation.

Research has demonstrated that Fz2 links to intracellular calcium signaling in Drosophila neurons. Specifically, activation of Go by dFz2 evokes Ca²⁺ signals, which can be rescued by over-expression of the ER Ca²⁺ depletion sensor dSTIM, suggesting a mechanistic pathway from receptor activation to calcium signaling .

What experimental approaches are most effective for studying functional redundancy between Fz1 and Fz2?

Methodological Approach:
To investigate the functional redundancy between Fz1 and Fz2, researchers can implement several strategic approaches:

  • Double knockout/knockdown experiments: Generate Fz1/Fz2 double mutants using CRISPR-Cas9 or RNAi techniques to observe comprehensive phenotypes that may not be apparent in single gene manipulations .

  • Domain swapping experiments: Create chimeric proteins containing domains from each receptor to determine which structural elements confer functional specificity versus redundancy.

  • Rescue experiments: Test whether over-expression of Fz1 can rescue Fz2 loss-of-function phenotypes and vice versa, assessing the degree of functional interchangeability .

  • Tissue-specific knockout combinations: Use the GAL4-UAS system to perform tissue-specific knockdowns of Fz1 and Fz2 individually and in combination to map contexts where redundancy exists versus where receptor-specific functions are required.

How do post-translational modifications affect recombinant Fz2 function and binding properties?

Methodological Approach:
Investigating post-translational modifications (PTMs) of recombinant Fz2 requires systematic analysis using these techniques:

  • Mass spectrometry analysis: Identify specific PTM sites on recombinant Fz2 proteins expressed in different systems (bacterial, insect, mammalian cells).

  • Site-directed mutagenesis: Generate Fz2 variants with mutations at potential PTM sites to assess their impact on Wnt binding affinity, receptor trafficking, and signaling capacity.

  • Glycosylation analysis: Compare differentially glycosylated forms of recombinant Fz2 for functional differences in binding assays and signaling outputs.

  • Phosphorylation mapping: Use phospho-specific antibodies or mass spectrometry to identify phosphorylation sites that may regulate Fz2 activity in different signaling contexts.

Current research indicates that proper folding and post-translational modifications, particularly glycosylation of the extracellular domain, are critical for the function of Frizzled receptors. These modifications can significantly impact the binding affinity for Wnt ligands and the receptor's ability to activate downstream signaling cascades.

What expression systems are optimal for producing functional recombinant Drosophila Fz2?

When producing recombinant Drosophila Fz2, researchers must consider several expression systems, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, low cost, rapid productionLacks PTMs, difficulty with membrane proteinsExtracellular domain production, protein fragment analysis
Insect cells (Sf9, S2)Native-like PTMs, proper foldingModerate yield, more expensive than bacteriaFull-length receptor production, functional studies
Mammalian cells (HEK293, CHO)Complex glycosylation, authentic traffickingLower yield, highest costBinding assays, signaling studies, structural analysis
Cell-free systemsRapid, avoids cellular toxicityLimited PTMs, lower yieldInitial screening, mutant protein production

For functional studies investigating Fz2's role in non-canonical calcium signaling pathways, insect cell expression systems (particularly Drosophila S2 cells) are often preferred as they provide a more native-like environment for proper protein folding and processing while maintaining reasonable yields.

What methodological approaches are most effective for studying Fz2-mediated calcium signaling in neuronal development?

Methodological Approach:
To investigate Fz2-mediated calcium signaling in neuronal development, researchers can implement:

  • Ex vivo calcium imaging: Using genetically encoded calcium indicators (GECIs) like GCaMP in isolated Drosophila brains to visualize calcium transients in real-time upon Wnt stimulation or Fz2 manipulation.

  • Targeted genetic manipulation: Employ the GAL4-UAS system for temporal and spatial control of Fz2 expression or knockdown specifically in dopaminergic neurons or other neuronal populations of interest.

  • Electrophysiological recordings: Combine patch-clamp recordings with calcium imaging to correlate calcium signals with neuronal activity patterns in wild-type versus Fz2-deficient neurons.

  • Pharmacological interventions: Use specific inhibitors of calcium signaling components (IP₃R antagonists, SOCE inhibitors) in combination with Fz2 manipulations to dissect the pathway.

Research has demonstrated that Fz2/Ca²⁺ signaling is specifically required for determining the final differentiated state of the protocerebral anterior medial (PAM) cluster of dopaminergic neurons. When this signaling is disrupted during pupal development, there is reduced Tyrosine Hydroxylase expression in these neurons, which affects their ability to properly reinforce flight behavior .

How can CRISPR-Cas9 technology be optimized for generating Fz2 mutants in Drosophila?

Methodological Approach:
For generating precise Fz2 mutants using CRISPR-Cas9, consider these optimized strategies:

  • gRNA design optimization:

    • Target conserved functional domains in the Fz2 gene

    • Use algorithms to minimize off-target effects

    • Design multiple gRNAs targeting different exons to increase editing efficiency

  • Delivery method selection:

    • For germline mutations: microinjection of Cas9 protein and gRNA into embryos

    • For somatic mosaics: tissue-specific Cas9 expression using the GAL4-UAS system

    • For temporal control: temperature-sensitive or drug-inducible Cas9 expression

  • Mutation verification protocol:

    • Initial screening via T7 endonuclease assay or heteroduplex mobility assay

    • Confirmation by direct sequencing of targeted loci

    • Functional validation through protein expression analysis and phenotypic assessment

  • Phenotypic analysis strategy:

    • Generate mosaic clones to study cell-autonomous effects

    • Compare with RNAi knockdown phenotypes to validate consistency

    • Perform rescue experiments with wild-type and mutant Fz2 variants

Studies using CRISPR-Cas9 to generate Fz2 mutants in butterflies have shown that injecting a Cas9/sgRNA duplex in syncytial embryos resulted in healthy adult butterflies with highly efficient and penetrant wing color pattern phenotypes, demonstrating the effectiveness of this approach for studying Fz2 function .

How does recombinant Fz2 differentially activate canonical versus non-canonical Wnt pathways?

Recombinant Fz2 can activate both canonical and non-canonical Wnt pathways, with the outcome depending on cellular context and co-receptor availability:

Canonical Wnt Pathway Activation:
In the canonical pathway, Fz2 partners with LRP5/6 (encoded by Arrow in Drosophila) to activate Dishevelled upon Wg binding. Activated Dishevelled functions to stabilize β-catenin (Armadillo in Drosophila), promoting its nuclear entry and subsequent transcription of target genes . This pathway is particularly important in developmental contexts requiring cell fate determination and tissue patterning.

Non-canonical Calcium Pathway Activation:
For non-canonical calcium signaling, Fz2 activation leads to G protein (specifically Go) stimulation, which triggers calcium release through the IP₃R. This release leads to clustering of dSTIM (the ER calcium depletion sensor), which promotes Store-operated Calcium Entry (SOCE) through dOrai . This pathway is critical for neuronal development, particularly in dopaminergic neurons affecting flight behavior.

Interestingly, research shows that up-regulation of canonical signaling molecules did not rescue flight deficits resulting from Fz2 down-regulation, suggesting that Fz2's role in flight circuit development specifically requires the non-canonical calcium signaling pathway .

What experimental contradictions exist in the literature regarding Fz2 function, and how can they be resolved?

Several experimental contradictions regarding Fz2 function appear in the literature, requiring careful analysis to resolve:

  • Redundancy versus Specificity Contradiction:

    • Some studies indicate complete functional redundancy between Fz1 and Fz2 for Wg signal transduction

    • Other research suggests Fz2-specific roles in calcium signaling that cannot be compensated by Fz1

    Resolution Approach: Conduct detailed domain-swap experiments between Fz1 and Fz2, followed by functional assays in both canonical and non-canonical pathway contexts to identify which protein domains confer specificity versus redundancy.

  • Developmental Requirement Contradiction:

    • In Drosophila, Fz2 knockdown alone shows limited phenotypic effects in wing development

    • In butterflies, Fz2 crispants show highly efficient and penetrant wing color pattern phenotypes

    Resolution Approach: Perform comparative evolutionary analyses across insect species, examining Fz2 sequence conservation and expression patterns in conjunction with functional studies to determine species-specific roles.

  • Wg Reception Contradiction:

    • Some data suggest Fz2 is essential for all Wg signaling

    • Other evidence indicates Wg-positive patterns such as the D2 element are unaffected by Fz2 KO in certain nymphalid butterflies

    Resolution Approach: Investigate potential compensatory mechanisms by systematically knocking down multiple Frizzled receptors in combination and analyzing tissue-specific receptor expression patterns.

How can phosphoproteomic analysis be used to map Fz2-initiated signaling networks?

Methodological Approach:
Phosphoproteomic analysis offers powerful insights into Fz2-initiated signaling networks through these strategic methods:

  • Temporal phosphorylation profiling:

    • Express recombinant Fz2 in a suitable cell system (e.g., Drosophila S2 cells)

    • Stimulate with purified Wg at defined time points (30s, 2min, 5min, 15min, 30min)

    • Use mass spectrometry to identify phosphorylated proteins at each time point

    • Construct temporal maps of phosphorylation events to identify early versus late signaling events

  • Pathway-specific phosphorylation analysis:

    • Compare phosphorylation patterns between cells expressing wild-type Fz2 versus mutants deficient in canonical or non-canonical pathway activation

    • Use pharmacological inhibitors of specific pathway components to identify dependent phosphorylation events

    • Integrate data to construct pathway-specific phosphorylation signatures

  • Functional validation of novel targets:

    • Select candidates from phosphoproteomic screening for functional validation

    • Generate phospho-mimetic and phospho-deficient mutants of key targets

    • Assess their effects on downstream signaling outputs and biological responses

This approach has revealed that Fz2 activation triggers distinct phosphorylation cascades leading to either β-catenin stabilization (canonical pathway) or calcium mobilization (non-canonical pathway), with significant cross-regulation between these networks.

How is Fz2 expression regulated during Drosophila development?

Fz2 expression during Drosophila development is subject to complex spatial and temporal regulation:

  • Transcriptional feedback regulation: Research indicates that Fz2 is under negative transcriptional feedback from Wg signaling, similarly to the Wg/Fz2 pair in Drosophila . This negative feedback loop helps to fine-tune Wg signaling activity across developing tissues.

  • Developmental stage-specific expression: During pupal wing development, Fz2 expression patterns change to support the maturation of specific neural circuits, particularly those involved in flight behavior. The precise timing of this expression is critical for proper neuronal differentiation and circuit formation .

  • Tissue-specific regulation: Fz2 expression is dynamically regulated across different tissues and developmental contexts, with particularly important roles in the wing imaginal disc and central nervous system. This tissue-specific expression contributes to the diverse functions of Fz2 in different developmental processes .

The regulatory mechanisms controlling Fz2 expression involve both Wnt-dependent feedback loops and Wnt-independent transcriptional regulators that respond to developmental cues specific to each tissue and developmental stage.

What evolutionary insights can be gained from comparing Drosophila Fz2 with vertebrate Frizzled receptors?

Comparative Analysis:
Evolutionary comparisons between Drosophila Fz2 and vertebrate Frizzled receptors reveal several important insights:

  • Functional conservation and divergence:

    • Like Drosophila Fz2, vertebrate Frizzled receptors (particularly Fzd2) are involved in both canonical and non-canonical Wnt signaling

    • Vertebrate non-canonical Frizzled2 signaling generates calcium transients that determine neuronal polarity, migration, and synapse assembly, showing functional conservation with Drosophila Fz2's role in neuronal development

    • Human FZD2 (orthologous to Drosophila Fz2) is implicated in omodysplasia 2, a developmental disorder affecting limb formation

  • Receptor specialization:

    • Vertebrates have expanded their Frizzled receptor family to 10 members compared to Drosophila's 4

    • This expansion has allowed greater specialization of receptor functions in vertebrates

    • Despite this expansion, core signaling mechanisms remain remarkably conserved

  • Signaling pathway conservation:

    • Both vertebrate and Drosophila Fz2 activate calcium signaling through similar mechanisms

    • The basic components of Wnt/Frizzled signal transduction (Dishevelled, β-catenin, TCF/LEF) are conserved across species

These evolutionary comparisons suggest that Frizzled2's dual role in canonical and non-canonical Wnt signaling represents an ancient function that predates the divergence of insects and vertebrates, highlighting the fundamental importance of these signaling mechanisms in animal development.

How do Fz2-dependent developmental processes vary across different insect species?

Comparative Analysis:
Fz2-dependent developmental processes show both conservation and variation across insect species:

  • Color pattern development:

    • In butterflies (Nymphalidae family), Fz2 is crucial for wing color pattern formation, where it functions as the primary receptor for WntA morphogen

    • While WntA mosaic clones result in intermediate patterns of reduced size (consistent with a morphogen function), Fz2 clones are cell-autonomous, suggesting a direct receptor role

    • In Drosophila, Fz2's role in color patterning is less pronounced due to functional redundancy with Fz1

  • Neural development:

    • In Drosophila, Fz2/Ca²⁺ signaling is specifically required for the differentiation of the PAM cluster of dopaminergic neurons involved in flight behavior

    • Similar neural functions of Fz2 in other insect species remain less characterized, representing an important area for future research

  • Wing development:

    • Fz2 crispants in butterflies showed highly efficient and penetrant wing color pattern phenotypes

    • In contrast, Fz2 mKO butterflies developed healthy adult wings without detectable deleterious impacts on wing development (unlike por and wls mKOs)

    • This suggests variability in how Fz2 contributes to wing development across different insect lineages

These comparative studies highlight how a conserved signaling receptor can evolve to acquire specialized functions in different insect lineages, providing insights into the molecular basis of morphological diversification in insects.

What are the most promising approaches for developing Fz2-based tools for neurobiological research?

Methodological Perspective:
Several innovative approaches can leverage Fz2 biology for neurobiological research tools:

  • Optogenetic Fz2 variants:

    • Engineer light-sensitive Fz2 receptors that can be activated with specific wavelengths of light

    • This would allow precise spatiotemporal control of Wnt signaling in neural tissues

    • Particularly valuable for studying how Fz2-mediated calcium signaling influences neuronal differentiation and circuit formation

  • Biosensor development:

    • Create FRET-based biosensors that report on Fz2 activation states in live neurons

    • Design split-fluorescent protein systems where Fz2 interaction with downstream effectors reconstitutes fluorescence

    • These tools would enable visualization of Wnt signaling dynamics in real-time during neural development

  • Engineered ligand-receptor pairs:

    • Develop modified Wnt-Fz2 pairs that interact exclusively with each other

    • This would allow selective activation of specific signaling pathways in defined neural populations

    • Valuable for dissecting the relative contributions of canonical versus non-canonical Wnt signaling in neural development

These approaches would substantially advance our understanding of how Fz2-mediated signaling contributes to neuronal differentiation, particularly in dopaminergic neurons where Fz2/Ca²⁺ signaling determines the final differentiated state .

How can contradictory findings about Fz2 function be reconciled through advanced experimental designs?

Advanced Experimental Approaches:
To resolve contradictions in Fz2 functional studies, these sophisticated experimental designs are recommended:

  • Single-cell multi-omics analysis:

    • Combine single-cell transcriptomics, proteomics, and phosphoproteomics in wild-type versus Fz2-deficient tissues

    • This integrative approach can reveal cell type-specific Fz2 functions that may be masked in bulk tissue analyses

    • Could help explain why some tissues show redundancy between Fz1 and Fz2 while others exhibit Fz2-specific requirements

  • Precise temporal manipulation studies:

    • Use temporally controlled expression/knockout systems (e.g., temperature-sensitive GAL80)

    • Target Fz2 function at specific developmental windows to determine when Fz2 activity is critical

    • This approach could resolve contradictions by identifying specific developmental periods when Fz2 function is non-redundant

  • Pathway-specific Fz2 variants:

    • Engineer Fz2 variants that selectively activate either canonical or non-canonical pathways

    • Test these variants in rescue experiments to determine which signaling output is required in different contexts

    • Could explain contradictory findings by revealing context-dependent signaling requirements

  • Interspecies complementation experiments:

    • Express Fz2 from different insect species in Drosophila Fz1/Fz2 double mutants

    • Assess functional conservation and divergence across species

    • Could help explain why Fz2 has more pronounced functions in some species than others

These approaches collectively address contradictions by providing higher-resolution analysis of Fz2 function across different cellular contexts, developmental stages, and signaling outputs.

What are the most significant technical challenges in producing functional recombinant Fz2 for structural studies?

Technical Analysis:
Producing recombinant Fz2 for structural studies presents several significant challenges:

  • Membrane protein expression and purification challenges:

    • As a seven-pass transmembrane protein, Fz2 is inherently difficult to express in soluble form

    • Conventional detergent-based purification methods often destabilize the native conformation

    • Solution: Utilize nanodiscs, styrene maleic acid lipid particles (SMALPs), or amphipol systems to maintain a lipid environment around the receptor

  • Post-translational modification requirements:

    • Proper folding and function of Fz2 likely depends on glycosylation and other PTMs

    • Bacterial expression systems lack appropriate machinery for these modifications

    • Solution: Express in insect or mammalian cells, or develop semi-synthetic approaches combining recombinant domains with synthetic peptides

  • Conformational heterogeneity:

    • Frizzled receptors exhibit significant conformational flexibility

    • This heterogeneity complicates structural determination by X-ray crystallography

    • Solution: Use cryo-electron microscopy, which can capture multiple conformational states, potentially in complex with Wnt ligands and downstream effectors

  • Ligand complexation challenges:

    • Wnt proteins are lipid-modified and challenging to produce recombinantly

    • Co-crystallization of Fz2-Wnt complexes presents additional complexity

    • Solution: Utilize surrogate ligands like nanobodies or develop water-soluble Wnt variants for co-expression studies

Addressing these challenges requires integrating advanced membrane protein biochemistry with cutting-edge structural biology approaches. Recent advances in cryo-EM technologies offer promising avenues for determining the structure of Fz2 alone and in complex with its signaling partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.