Recombinant Drosophila melanogaster Frizzled-3 (fz3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Gene and Protein Details

  • Gene Name: fz3 (also annotated as CG16785, dfz3, or Dm Fz3) .

  • UniProt ID: O77438 .

  • Protein Structure:

    • Seven-transmembrane domain receptor with a conserved extracellular cysteine-rich domain (CRD) for ligand binding .

    • Isoforms include full-length (20–581 amino acids) and partial constructs for specific assays .

    • Key sequence regions: CRD (ligand-binding), intracellular domains for signaling cascade activation .

Recombinant Production

PropertyDetails
Expression SystemsE. coli, yeast, baculovirus, or mammalian cells .
TagsHis-tag (common), others determined during production .
Purity≥85% (SDS-PAGE verified) .
StorageTris/PBS buffer with 50% glycerol; store at –20°C/–80°C .

Functional Roles and Mechanisms

Biological Functions

  • Planar Cell Polarity (PCP): Localizes to lateral faces of sensory cells, directing hair bundle orientation in auditory and vestibular systems .

  • Axon Guidance: Critical for thalamocortical, corticothalamic, and nigrostriatal tract development .

  • Developmental Signaling: Cooperates with Frizzled-6 (Fz6) and Vangl2 in neural tube closure and eyelid fusion .

Mechanistic Insights

  • Wnt Signaling: Engages non-canonical PCP pathways rather than β-catenin-mediated canonical pathways .

  • Localization Patterns: Asymmetric distribution in sensory epithelia correlates with polarity axes .

  • Redundancy: Functional overlap with Fz6 observed in double-knockout models (e.g., craniorachischisis in Fz3⁻/⁻;Fz6⁻/⁻ mice) .

Research Applications

Experimental Use Cases

ApplicationProtocol DetailsSource
ELISAQuantification using anti-Fz3 antibodies .
Western BlotDetected via Rabbit anti-Fz3 polyclonal IgG .
ImmunohistochemistryTissue-specific localization in neural epithelia .

Key Findings from Studies

  • Neural Defects: Fz3⁻/⁻ mice exhibit thalamocortical tract loss and striatal cell death .

  • Sensory Cell Polarity: Fz3/6 double mutants show misoriented hair bundles in inner ear epithelia .

  • Evolutionary Conservation: Functional parallels with Xenopus Fzd3 and mammalian homologs .

Significance in Biomedical Research

Recombinant Fz3 enables mechanistic studies of Wnt/PCP signaling defects linked to neural tube anomalies (e.g., spina bifida) and sensory disorders . Its role in axon guidance further implicates it in neurodevelopmental disease models.

For extended storage, aliquot reconstituted protein (0.1–1.0 mg/mL) with 50% glycerol . Avoid repeated freeze-thaw cycles to maintain stability .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
fz3; CG16785; Frizzled-3; dFz3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-581
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
fz3
Target Protein Sequence
ANGAGHNGPVASGAGPNGLQCQPIAVSACQGLGYNMTALPNLAGHTNQLEAELQIAKLVP LIESGCSRRARFLLCSSLFPLCTPDVPRPVAACKLLCETVRGECMENAPPELMELWPSFL NCDGLPQPEKHELCMQIPQEVAVPGGSPSGPPTTGSPGVEDHPQTYRFWKSGASPTSDLA GVLCPQNFSGSPFNPEECVPQCQRDAFHTSSQKKTSETLILGLSAVCFVLTLFALVTFWA EPTRFGYPERPVLFLCLCYNLFSVCYLERIVFHNQARMHDVELQGRLMRPGCLLTPPCLA SYITTSYLSLCAASWWLIFALCFYLSSHKKWSSEALEKRSGLFHVLAWVPPLAPPIAALL LEKVRPSELTGMCYAPGFVELPALVLLLLGLYFTLRASRSLLSLQQQLQPTLAHHRFGQI RKRFVLFSLLYFAPTTAGVVAALCERYADSVPSCSTPDDCLSPTPLSAWPALVRIFFQLV GGTLTGLWVWSRKTCESYRNRLGASGTPTSSLMNQSKAAGALPKKHLYTSGKSMLPTGGI TPLYAGISFHNVPVYNPNQSRV
Uniprot No.

Target Background

Function
Frizzled-3 (fz3) is a receptor for Wnt proteins. Most Frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of Dishevelled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin, and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed for some family members. However, it remains unclear if this represents a distinct pathway or if it integrates into the canonical pathway, as PKC appears to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Frizzled-3 is essential for coordinating the cytoskeletons of epidermal cells to produce a parallel array of cuticular hairs and bristles.
Database Links

KEGG: dme:Dmel_CG16785

STRING: 7227.FBpp0111841

UniGene: Dm.1697

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Wing, leg and eye imaginal disks. In embryos, expressed is seen in brain, proventriculus, Malpighian tubules, anal plate and visceral mesoderm of parasegment 8.

Q&A

What is Drosophila melanogaster Frizzled-3 (Fz3) and how is it structurally characterized?

Drosophila melanogaster Frizzled-3 (Fz3) is a transmembrane protein that functions as a receptor in the Wnt signaling pathway. Recombinant Fz3 protein typically encompasses amino acids 20-581 of the mature protein and contains multiple functional domains. The full amino acid sequence begins with "ANGAGHNGPVASGAGPNGLQCQPIAVSACQG..." and continues through a series of structurally important regions. When expressed recombinantly, Fz3 is commonly produced in E. coli expression systems with an N-terminal His-tag to facilitate purification and downstream applications .

The protein has several synonyms in scientific literature, including fz3, CG16785, and dFz3, with the UniProt ID O77438. Its mature form consists of extracellular, transmembrane, and cytoplasmic domains that collectively enable its function in developmental signaling processes. The recombinant protein's structural integrity is critical for maintaining its functional relevance in experimental systems designed to study Wnt pathway mechanics .

How should recombinant Fz3 protein be stored and handled to maintain optimal activity?

For optimal stability and activity retention, recombinant Drosophila melanogaster Fz3 protein requires specific storage and handling protocols:

Storage ConditionRecommended DurationNotes
4°CUp to one weekFor working aliquots only
-20°CMedium-term storageSuitable for routine use
-80°CLong-term storageRecommended for extended preservation

The recombinant protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For prolonged stability, addition of glycerol to a final concentration of 5-50% is recommended before aliquoting and storing at -20°C or -80°C . The standard storage buffer composition includes a Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

Importantly, repeated freeze-thaw cycles significantly compromise protein integrity and should be strictly avoided. This necessitates preparing appropriately sized single-use aliquots during initial reconstitution. When working with the protein, gentle handling is essential; excessive vortexing or agitation should be minimized to prevent denaturation .

What are the recommended protocols for using recombinant Fz3 in cell-based Wnt signaling assays?

When designing cell-based assays to study Wnt signaling using recombinant Drosophila melanogaster Fz3, researchers should consider several methodological approaches:

  • Receptor-ligand binding studies:

    • Utilize purified recombinant Fz3 (>90% purity as determined by SDS-PAGE) at concentrations between 10-100 nM

    • Pre-coat culture plates with the protein to assess direct binding with purified Wnt ligands

    • Include appropriate controls with known Wnt pathway modulators

  • Competitive binding assays:

    • Employ fluorescently labeled Wnt ligands competed with increasing concentrations of recombinant Fz3

    • Quantify using fluorescence polarization or similar techniques

    • Plot displacement curves to determine binding affinities

  • Transfection-based systems:

    • For cells with low endogenous Fz3 expression, transfect with plasmids encoding Drosophila Fz3

    • Apply the recombinant protein (0.1-1 μg/mL) to culture medium to competitively inhibit endogenous Wnt-Fz interactions

    • Monitor downstream signaling effects using TOPflash reporter assays or β-catenin nuclear translocation

When optimizing these protocols, it's crucial to perform preliminary dose-response experiments to determine optimal protein concentrations for your specific cellular system. The recombinant protein should be reconstituted according to manufacturer specifications, typically in a Tris-based buffer with appropriate stabilizers to maintain functional activity throughout the experimental timeline .

How can recombinant Fz3 be effectively used in protein-protein interaction studies?

Protein-protein interaction studies with recombinant Drosophila melanogaster Fz3 require careful experimental design to capture physiologically relevant interactions while minimizing artifacts. Several methodological approaches have proven effective:

  • Pull-down assays:

    • Immobilize His-tagged recombinant Fz3 on Ni-NTA resin

    • Incubate with candidate interacting proteins or tissue/cell lysates

    • Wash extensively with buffers containing low imidazole concentrations (10-20 mM)

    • Elute bound complexes with higher imidazole (250-500 mM)

    • Analyze via SDS-PAGE and western blotting or mass spectrometry

  • Surface Plasmon Resonance (SPR):

    • Immobilize recombinant Fz3 on sensor chips via His-tag

    • Introduce potential binding partners in solution phase

    • Measure association and dissociation kinetics

    • Calculate binding constants to quantify interaction strengths

  • Co-immunoprecipitation validation:

    • Use anti-His antibodies to precipitate recombinant Fz3 with its binding partners

    • Perform reciprocal experiments using antibodies against putative interactors

    • Include appropriate negative controls (irrelevant proteins with similar tags)

The high purity (>90%) of commercially available recombinant Fz3 is particularly advantageous for these applications, as it minimizes non-specific interactions. When designing experiments, consider including detergents (0.1% Triton X-100 or similar) in buffers when working with this transmembrane protein to maintain proper folding and accessibility of binding sites .

What developmental processes are regulated by Frizzled-3 in Drosophila melanogaster?

Frizzled-3 (Fz3) participates in multiple critical developmental processes in Drosophila melanogaster, with significant functional overlap with Frizzled-6 (Fz6). Key developmental roles include:

  • Neural tube closure:

    • Fz3 and Fz6 function redundantly in this process

    • Fz3−/−;Fz6−/− double mutant embryos exhibit craniorachischisis (completely open neural tube) with nearly 100% penetrance

    • This phenotype demonstrates the essential role of these receptors in neurulation

  • Planar cell polarity regulation:

    • Fz3 controls the planar orientation of sensory structures

    • In the inner ear, Fz3 proteins localize to lateral faces of sensory and supporting cells

    • The pattern of localization correlates with the axis of planar polarity

    • Interestingly, polarity orientation differs between vestibular hair cells in the semicircular canals and auditory hair cells in the organ of Corti

  • Axonal growth and guidance:

    • Fz3 plays a critical role in controlling axonal growth in the central nervous system

    • It participates in the development of major fiber tracts in the brain

  • Epithelial sheet migration:

    • Approximately 10% of Fz3−/−;Fz6−/− embryos display unfused eyelids at E18

    • This phenotype relates to defects in the directed migration and proliferation of paired epithelial sheets

These developmental functions are enabled through Fz3's participation in Wnt signaling pathways, which regulate cell fate decisions, cell polarity, and morphogenetic movements during embryogenesis. The distinct and overlapping functions with other Frizzled family members highlight the complex regulatory networks guiding Drosophila development .

How does Frizzled-3 interact with the Wnt signaling pathway in Drosophila compared to vertebrate systems?

Frizzled-3 serves as a critical receptor component in both canonical and non-canonical Wnt signaling pathways, with notable similarities and differences between Drosophila and vertebrate systems:

  • Evolutionary conservation:

    • Drosophila Fz3 shares significant sequence homology with vertebrate counterparts

    • The protein structure places Fz3 and Fz6 together on a distinct evolutionary branch within the Frizzled family

    • This structural conservation suggests fundamental similarities in signaling mechanisms

  • Functional redundancy:

    • In Drosophila, Fz3 shows substantial redundancy with Fz6

    • This mirrors observations that Drosophila Fz and Fz2 exhibit functional overlap

    • The redundancy pattern appears conserved in vertebrates, where multiple Fz receptors can compensate for each other

  • Planar Cell Polarity (PCP) signaling:

    • In both systems, Fz3 participates in the non-canonical Wnt/PCP pathway

    • Fz3 interacts with Vangl2 (a mammalian homolog of Drosophila PCP gene)

    • The asymmetric localization of Fz3 in tissues is critical for establishing polarity

    • Loss of Vangl2 disrupts this localization pattern in both systems

  • Pathway specificity:

    • Drosophila Fz3 shows preferential activation of certain Wnt ligands

    • The receptor's extracellular domain contains a cysteine-rich domain that determines ligand specificity

    • This specificity pattern is generally conserved in vertebrate orthologs

The study of recombinant Drosophila Fz3 has provided valuable insights into these conserved mechanisms, allowing researchers to establish fundamental principles that often translate to vertebrate systems. The protein's involvement in both canonical (β-catenin-dependent) and non-canonical (PCP and calcium-dependent) Wnt pathways makes it an important model for understanding signal transduction across species .

What are the critical factors to consider when designing structure-function studies using recombinant Fz3 fragments?

Structure-function analyses of Drosophila melanogaster Frizzled-3 require careful experimental design to yield meaningful insights into domain-specific activities. Key considerations include:

  • Domain boundary definition:

    • The extracellular cysteine-rich domain (CRD) is critical for Wnt ligand binding

    • Transmembrane domains must be properly delineated to maintain structural integrity

    • The C-terminal cytoplasmic domain contains motifs essential for downstream signaling

    • Consult protein prediction algorithms and existing structural data to accurately define domain boundaries

  • Expression system selection:

    • For full-length or multi-domain constructs, mammalian or insect cell systems often provide better folding than E. coli

    • For individual domains (particularly the CRD), E. coli expression can be optimized with appropriate fusion tags

    • Consider using the full amino acid sequence (ANGAGHNGPVASGAGPNGLQCQPIAVSACQG...) for proper context, or design domain-specific constructs

  • Protein solubility and stability:

    • Transmembrane regions require detergent or lipid reconstitution

    • Include stabilizing agents such as trehalose (6%) in buffers

    • Monitor protein stability using thermal shift assays or limited proteolysis

    • Examine multiple buffer conditions to optimize protein folding

  • Functional validation methods:

    • For CRD fragments, verify Wnt binding using biophysical techniques

    • For transmembrane domains, assess membrane integration using flotation assays

    • For cytoplasmic domains, evaluate interactions with known binding partners

The high purity (>90%) of commercially available recombinant Fz3 provides an excellent reference standard for validating your domain constructs. When designing truncation or mutation experiments, consider the evolutionary conservation of specific amino acids across species as a guide to functionally important residues .

How can researchers effectively troubleshoot non-specific binding issues when using recombinant Fz3 in binding assays?

Non-specific binding is a common challenge when working with transmembrane proteins like Frizzled-3 in binding assays. A systematic troubleshooting approach includes:

  • Buffer optimization:

    • Test multiple buffer compositions with varying salt concentrations (150-500 mM NaCl)

    • Incorporate mild detergents (0.01-0.1% Triton X-100 or NP-40) to reduce hydrophobic interactions

    • Include carrier proteins (0.1-1% BSA) to block non-specific binding sites

    • Use a Tris/PBS-based buffer system as a starting point, adjusting pH between 7.4-8.0

  • Blocking strategy refinement:

    • Compare different blocking agents (BSA, milk, casein, commercial blocking buffers)

    • Implement stepped blocking protocols (initial block followed by secondary block)

    • Extend blocking time (1-3 hours or overnight at 4°C) for problematic samples

  • Assay-specific controls:

    • Include competition controls with unlabeled ligand

    • Perform parallel experiments with irrelevant proteins of similar structure

    • Use gradient concentrations of recombinant Fz3 to establish signal-to-noise ratios

    • Include a known binding partner as positive control

  • Sample preparation modifications:

    • Centrifuge reconstituted protein solutions (10,000 × g, 10 minutes) to remove aggregates

    • Filter solutions through 0.22 μm filters to eliminate particulates

    • Pre-clear biological samples by incubation with the immobilization matrix alone

  • Data analysis approaches:

    • Implement subtraction of signal obtained from negative controls

    • Use Scatchard analysis to distinguish specific from non-specific binding

    • Apply appropriate statistical tests to determine significance of observed interactions

If persistent non-specific binding occurs despite these measures, consider alternative detection methods or assay formats. The highly purified nature (>90% as determined by SDS-PAGE) of commercial recombinant Fz3 preparations should minimize contaminant-related artifacts, allowing focus on optimizing the specific interaction parameters .

What are the key considerations for designing CRISPR-Cas9 knock-in experiments to tag endogenous Fz3 in Drosophila melanogaster?

Designing effective CRISPR-Cas9 knock-in strategies for tagging endogenous Frizzled-3 in Drosophila melanogaster requires careful consideration of multiple factors to ensure successful genomic modification while preserving protein function:

  • Tag selection and positioning:

    • Consider small epitope tags (FLAG, HA, V5) to minimize disruption of protein function

    • Position tags at either the N-terminus (after signal peptide cleavage site) or C-terminus

    • Avoid disrupting known functional domains or motifs

    • Include flexible linkers (e.g., Gly-Ser repeats) between the tag and Fz3 sequence

  • Guide RNA design:

    • Target sequences near the intended insertion site with minimal off-target potential

    • Verify PAM sites (NGG for SpCas9) are accessible in the genomic context

    • Design at least 3-4 guide RNAs per targeting strategy to increase success probability

    • Evaluate guide RNA efficiency using prediction algorithms

  • Homology-directed repair (HDR) template design:

    • Include 500-1000 bp homology arms flanking the insertion site

    • Incorporate silent mutations in the PAM site or guide RNA target sequence to prevent re-cutting

    • Consider using ssDNA templates for small insertions or dsDNA for larger tags

    • Maintain reading frame across the tag-protein junction

  • Validation strategy:

    • Design PCR primers spanning the insertion site for initial screening

    • Plan sequencing strategies to confirm precise integration

    • Develop antibody-based detection methods for the tagged protein

    • Include functional assays to verify the tagged protein maintains normal activity

  • Controls and verification:

    • Generate multiple independent lines to control for position effects

    • Compare expression patterns with known Fz3 localization data

    • Verify the tagged protein's subcellular localization matches published patterns showing Fz3 at the lateral faces of sensory and supporting cells

    • Test functional redundancy with Fz6 as observed in studies of neural tube closure

When designing knock-in experiments, reference the complete amino acid sequence and protein structure information available for recombinant Fz3 to guide tag placement decisions. Additionally, consider the known developmental phenotypes of Fz3−/− mutants as endpoints for functional validation of your tagged constructs .

How should researchers interpret conflicting results between recombinant protein assays and in vivo studies of Frizzled-3 function?

Reconciling discrepancies between recombinant protein-based experiments and in vivo observations requires systematic analysis of multiple experimental variables:

  • Protein conformation considerations:

    • Recombinant Fz3 produced in E. coli may lack post-translational modifications present in vivo

    • The His-tag used in commercial preparations could potentially affect protein folding or function

    • Evaluate whether the full-length mature protein (amino acids 20-581) was used, as truncated versions may exhibit altered activities

    • Consider how the lyophilized form may reconstitute differently than the native membrane-embedded protein

  • Context-dependent interactions:

    • In vivo, Fz3 functions within complex signaling networks with multiple cofactors

    • The presence of redundant receptors (particularly Fz6) may compensate for experimental perturbations in vivo

    • Examine whether the experimental system includes necessary cofactors like Vangl2, which interacts with Fz3 in planar cell polarity signaling

  • Methodological reconciliation approach:

    • Design intermediate experiments bridging in vitro and in vivo contexts (e.g., organoid cultures)

    • Perform dose-response studies to identify threshold effects present in one system but not the other

    • Develop temporal analyses to distinguish between acute versus developmental effects

    • Implement genetic rescue experiments with recombinant protein to validate functional equivalence

  • Integrated data analysis framework:

    • Create a comparative matrix of experimental conditions highlighting key differences

    • Weight evidence based on methodological rigor and reproducibility

    • Consider evolutionary conservation of observed effects across species

    • Examine how the observed redundancy between Fz3 and Fz6 might influence experimental outcomes

When confronted with conflicting data, reference the phenotypes of genetic models, particularly the craniorachischisis and neural tube closure defects documented in Fz3−/−;Fz6−/− double mutants, as foundational benchmarks for interpreting experimental manipulations .

What statistical approaches are most appropriate for analyzing dose-response data from recombinant Fz3 binding studies?

Analyzing dose-response data from recombinant Frizzled-3 binding studies requires robust statistical approaches tailored to the specific experimental design:

  • Nonlinear regression models:

    • For saturation binding data: Fit to one-site or two-site binding models

    • For competition assays: Apply sigmoidal dose-response curves with variable slope

    • For kinetic studies: Use association/dissociation exponential models

    • Calculate key parameters including Kd (dissociation constant), Bmax (maximum binding capacity), and IC50 values

  • Data transformation considerations:

    • Convert binding data to Scatchard or Lineweaver-Burk plots to visualize binding site characteristics

    • Apply log transformation to concentration values to properly display sigmoidal relationships

    • Normalize data to percent of maximum binding to facilitate comparison between experiments

  • Statistical significance testing:

    • For comparing binding parameters between conditions: Apply ANOVA with appropriate post-hoc tests

    • For replicate experiments: Calculate coefficient of variation to assess reproducibility

    • For outlier analysis: Apply Grubb's test or similar methods to identify problematic data points

    • Establish confidence intervals for derived binding parameters

  • Advanced analytical approaches:

    • Implement global fitting across multiple experiments to improve parameter estimation

    • Apply bootstrapping methods to generate robust confidence intervals

    • Consider Bayesian analysis for complex binding models with multiple parameters

    • Use Akaike Information Criterion (AIC) to compare goodness of fit between competing models

When analyzing Fz3 binding data, reference the experimental conditions including buffer composition (e.g., Tris/PBS-based buffer with 6% trehalose), protein concentration, and purity (>90% as determined by SDS-PAGE) to properly contextualize statistical findings. Additionally, consider how the His-tag present in recombinant preparations might influence binding parameters .

How are structural biology approaches advancing our understanding of Frizzled-3 receptor function?

Recent structural biology techniques have significantly enhanced our understanding of Frizzled receptor architecture and function, with important implications for Drosophila Frizzled-3 research:

  • Cryo-electron microscopy advances:

    • High-resolution structures of Frizzled receptors in complex with various ligands have revealed key binding interfaces

    • Conformational changes upon ligand binding provide mechanistic insights into signal transduction

    • Structural comparison across Frizzled family members helps explain ligand specificity differences

    • These approaches have been facilitated by the availability of highly purified recombinant proteins

  • Molecular dynamics simulations:

    • Computational modeling based on known Frizzled structures has elucidated membrane interactions

    • Simulations reveal how the transmembrane domains participate in signal transduction

    • The complete amino acid sequence of Drosophila Fz3 (ANGAGHNGPVASGAGPNGLQCQPIAVSACQG...) provides essential input for these models

  • Hydrogen-deuterium exchange mass spectrometry:

    • This technique has mapped dynamic regions of Frizzled receptors involved in conformational changes

    • Studies have identified previously unrecognized allosteric sites that influence receptor function

    • The approach provides insights into how mutations affect protein dynamics and signaling capacity

  • Single-molecule techniques:

    • Förster resonance energy transfer (FRET) studies have visualized receptor dimerization events

    • Single-particle tracking has revealed how Frizzled receptors cluster in response to Wnt binding

    • These approaches help explain the complex localization patterns observed for Fz3 in tissues like the inner ear sensory epithelia

Future structural biology efforts are likely to focus on capturing the dynamics of Fz3 interactions with both extracellular ligands and intracellular effectors, potentially resolving how this receptor contributes to the planar cell polarity defects observed in Fz3−/−;Fz6−/− double mutants . The continued refinement of recombinant protein production techniques will be essential for these advanced structural studies.

What emerging technologies are enabling new approaches to studying Frizzled-3 trafficking and localization?

Cutting-edge technologies are revolutionizing our ability to study the dynamic trafficking and precise localization of Frizzled-3 in cellular contexts:

  • Super-resolution microscopy approaches:

    • Stimulated emission depletion (STED) microscopy resolves Fz3 localization beyond the diffraction limit

    • Photoactivated localization microscopy (PALM) tracks single molecules of fluorescently tagged Fz3

    • Structured illumination microscopy (SIM) improves visualization of Fz3 distribution in membrane subdomains

    • These techniques have enhanced our understanding of the asymmetric localization of Fz3 to lateral cell faces in sensory epithelia

  • Optogenetic control systems:

    • Light-inducible protein interaction modules allow temporal control of Fz3 trafficking

    • Optogenetic clustering tools can simulate receptor activation in defined cellular locations

    • These approaches help dissect the relationship between localization and function in planar cell polarity

  • Genetically encoded biosensors:

    • FRET-based sensors detect Fz3 conformational changes upon ligand binding

    • Fluorescent timer proteins reveal the age and turnover rate of Fz3 populations

    • These tools provide dynamic information about receptor activity in various cellular compartments

  • Advanced genetic tagging strategies:

    • Split fluorescent protein complementation assays visualize Fz3 interactions with binding partners

    • Proximity labeling approaches (BioID, APEX) identify the local proteome around Fz3 in specific cellular contexts

    • These methods reveal previously unrecognized interaction networks

  • Tissue-specific and inducible expression systems:

    • Sophisticated GAL4/UAS systems with temporal control allow precise manipulation of Fz3 expression

    • Cell-type-specific CRISPR interference targets endogenous Fz3 in defined populations

    • These genetic tools help dissect the cell-autonomous versus non-autonomous functions in development

These technologies are particularly valuable for understanding how Fz3 trafficking contributes to its functional redundancy with Fz6 in processes like neural tube closure, and how its precise localization enables planar polarity establishment in sensory epithelia . When designing experiments with these approaches, researchers should reference the known localization patterns of Fz3 in tissues like the inner ear as benchmarks for validation.

What are the optimal conditions for reconstituting lyophilized recombinant Fz3 to maintain structural integrity?

Proper reconstitution of lyophilized recombinant Drosophila melanogaster Frizzled-3 is critical for downstream applications. The following protocol provides optimal conditions to maintain structural and functional integrity:

  • Pre-reconstitution preparation:

    • Allow the lyophilized protein to equilibrate to room temperature (20-25°C) before opening

    • Briefly centrifuge the vial (10,000 × g, 1 minute) to collect all material at the bottom

    • Work in a laminar flow hood if available to maintain sterility

  • Reconstitution procedure:

    • Add deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

    • Add water slowly, allowing it to run down the sides of the vial

    • Gently rotate or invert the vial to dissolve the protein completely

    • Avoid vigorous shaking, vortexing, or bubble formation

  • Buffer optimization:

    • The standard reconstitution buffer is Tris/PBS-based with 6% trehalose at pH 8.0

    • For enhanced stability, add glycerol to a final concentration of 5-50%

    • For membrane protein applications, consider adding mild detergents like 0.1% Triton X-100 or 0.5% CHAPS

  • Post-reconstitution processing:

    • Prepare appropriate sized aliquots to avoid repeated freeze-thaw cycles

    • Flash-freeze aliquots in liquid nitrogen before transferring to storage

    • Store working aliquots at 4°C for up to one week

    • Store long-term aliquots at -20°C or -80°C

  • Quality control verification:

    • Assess protein concentration using absorbance at 280 nm or Bradford/BCA assays

    • Verify integrity by SDS-PAGE (should show >90% purity)

    • Check functionality with a simple binding assay if possible

This protocol maximizes the retention of Fz3's native structure, which is essential for studies investigating its role in processes like neural tube closure and planar cell polarity signaling .

How can researchers effectively troubleshoot expression and purification issues when producing custom Frizzled-3 constructs?

When generating custom Frizzled-3 constructs for research applications, researchers often encounter expression and purification challenges. The following systematic troubleshooting approach addresses common issues:

  • Expression optimization strategies:

    IssueSolution ApproachRationale
    Low expression levelsModify codon usage for E. coli preferenceImproves translation efficiency
    Protein toxicityUse tightly regulated inducible promoters (T7lac)Minimizes leaky expression
    Inclusion body formationLower induction temperature (16-18°C)Promotes proper folding
    Premature terminationCheck for rare codons and optimize sequencePrevents ribosomal stalling
  • Solubility enhancement techniques:

    • Incorporate solubility-enhancing tags (SUMO, MBP, TrxA) at the N-terminus

    • Express only the extracellular domain (ECD) for ligand binding studies

    • Add 0.1-1% mild detergents to lysis buffers when working with full-length constructs

    • Include osmolytes like glycerol (5-10%) and trehalose (5-6%) in buffers

  • Purification optimization:

    • For His-tagged constructs, use imidazole gradients (20-250 mM) to improve specificity

    • Implement two-step purification (affinity followed by size exclusion chromatography)

    • Add reducing agents (1-5 mM DTT or 2-ME) to maintain cysteine residues

    • Optimize pH conditions (try range 7.0-8.5) to improve binding to affinity resins

  • Quality assessment methods:

    • Verify protein identity using western blotting with anti-His or Fz3-specific antibodies

    • Assess homogeneity using dynamic light scattering

    • Perform circular dichroism to evaluate secondary structure content

    • Compare functional activity to commercial standards (>90% pure preparations)

  • Refolding strategies (if needed):

    • Use stepwise dialysis to gradually remove denaturants

    • Add chaperone systems (GroEL/ES) during expression

    • Try oxidative refolding for cysteine-rich domains

    • Consider on-column refolding techniques

When troubleshooting, reference the amino acid sequence and structural features of commercially available recombinant Fz3 proteins as benchmarks. This approach will help ensure that custom constructs maintain the structural integrity needed for studying functions like those observed in neural tube closure and planar cell polarity establishment .

How can recombinant Fz3 be utilized to investigate neurodevelopmental disorders related to Wnt signaling disruption?

Recombinant Drosophila melanogaster Frizzled-3 offers valuable research tools for studying neurodevelopmental disorders with Wnt signaling abnormalities:

  • Comparative neurological phenotype analysis:

    • Fz3−/−;Fz6−/− double mutants exhibit craniorachischisis (open neural tube), providing a model for human neural tube defects

    • The role of Fz3 in axonal growth and guidance in the CNS makes it relevant for disorders involving axon pathfinding

    • Use of recombinant Fz3 in rescue experiments can establish structure-function relationships relevant to human pathologies

  • Receptor-ligand interaction screening:

    • Apply recombinant Fz3 in binding assays to screen compounds that modulate Wnt signaling

    • Test patient-derived Wnt variants for altered binding to Drosophila Fz3

    • Use competition assays to identify molecules that could normalize disrupted signaling

    • The high purity (>90%) of recombinant preparations enables reliable quantitative binding studies

  • Cross-species conservation analysis:

    • Exploit the evolutionary relationship between Drosophila and human Frizzled receptors

    • Create chimeric receptors with domains from human and Drosophila proteins

    • Test function in cellular assays to identify critical regions for signal transduction

    • Use the full amino acid sequence information to guide design of these constructs

  • Cellular model development:

    • Generate neuronal cultures with defined Fz3 expression levels

    • Apply recombinant Fz3 as a competitive inhibitor of endogenous signaling

    • Assess effects on axon outgrowth, neuronal polarization, and synaptogenesis

    • Correlate findings with known roles of Fz3 in controlling axonal growth in the CNS

  • Therapeutic screening platforms:

    • Develop high-throughput assays using recombinant Fz3 to identify modulators of Wnt signaling

    • Screen compound libraries for molecules that enhance or inhibit specific signaling cascades

    • Validate hits in Drosophila neural development models before moving to vertebrate systems

These approaches leverage the well-characterized properties of recombinant Drosophila Fz3 protein to provide insights into human neurodevelopmental disorders with disrupted Wnt signaling, creating translation potential from this model organism to human disease contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.