Recombinant Drosophila melanogaster Frizzled (fz)

Shipped with Ice Packs
In Stock

Description

Definition and Biochemical Characteristics

Frizzled (fz) belongs to the seven-pass transmembrane receptor family first identified in Drosophila melanogaster. The protein was named "frizzled" due to the disorganized appearance of bristle hairs in mutant flies lacking functional fz proteins . The recombinant form represents an artificially produced version of this protein, typically expressed in bacterial or mammalian expression systems for research purposes .

The frizzled gene in Drosophila encodes a receptor that remarkably controls two distinct signaling pathways: it directs planar cell polarization (PCP) of epithelia and regulates cell fate decisions through Armadillo (Arm) by acting as a receptor for the Wnt protein Wingless (Wg) . This dual functionality makes recombinant Frizzled proteins particularly valuable for investigating developmental processes and signal transduction mechanisms.

Physical and Biochemical Properties

Commercially available recombinant Drosophila melanogaster Frizzled proteins have the following specifications:

PropertySpecificationSource
Expression SystemE. coli or Mammalian cells
Protein LengthFull Length (19-581aa) or Partial
Molecular TagsOften His-tagged at N-terminal
Physical FormLyophilized powder
Purity>85% to >90% (SDS-PAGE)
UniProt IDP18537
Storage Conditions-20°C/-80°C
Shelf Life12 months (lyophilized) at -20°C/-80°C
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)

The recommended storage buffer typically contains Tris/PBS-based components with 6% Trehalose at pH 8.0, and manufacturers suggest adding glycerol (5-50% final concentration) for long-term storage .

Cysteine-Rich Domain Function

Interestingly, while the cysteine-rich domain (CRD) has long been considered essential for Wnt binding, research has provided evidence that the CRD might be dispensable for Frizzled family receptors to transduce Wingless (Wg) signals in Drosophila . This unexpected finding suggests that signal transduction might depend on interactions between Wg and other portions of the receptor, or other proteins in the receptor complex, representing a significant shift in our understanding of Frizzled function .

Role in Canonical Wnt Signaling

The Drosophila genome encodes seven Wnts and four proteins of the Frizzled family . Wingless (Wg) serves as the predominant Wnt signal in Drosophila and is transduced by two of the four Frizzled proteins: Fz and Dfz2 . These receptors activate the canonical Armadillo/β-catenin pathway, which is involved in:

  • Embryonic development

  • Cell fate determination

  • Tissue patterning

  • Regulation of cell proliferation

Role in Planar Cell Polarity

Beyond its function in canonical Wnt signaling, Frizzled plays a critical and nonredundant role in directing the planar cell polarization (PCP) of epithelia . PCP refers to the organization of cellular structures in a plane orthogonal to the apical-basal axis and oriented relative to the body axes. Examples include:

  • Wing hairs pointing toward the distal tip of the wing

  • Hairs and bristles on the dorsal thorax pointing posteriorly

This epithelial polarity is essential for proper tissue organization and function. Unlike its role in Wnt signaling, Frizzled's function in PCP is unique and not shared with other family members, making it particularly significant for developmental processes .

Distinct Mechanisms in Different Pathways

Research has revealed that Frizzled may employ different mechanisms when functioning in canonical Wnt signaling versus PCP pathways. Through structure-function dissection using mutagenesis approaches, researchers have identified missense mutations in cytosolic-facing regions of the Frizzled receptor that block Dishevelled recruitment .

Most significantly, while some mutations affect both planar polarity and canonical activity, a subset specifically disrupts only planar polarity activity without impacting canonical Wnt signaling . This finding supports the view that qualitatively different Frizzled-Dishevelled interactions underlie these two signaling pathways .

Research Applications

Recombinant Drosophila melanogaster Frizzled serves numerous research purposes:

  1. Structural Studies: Investigating the three-dimensional architecture of Frizzled receptors

  2. Binding Assays: Evaluating interactions between Frizzled and potential ligands or inhibitors

  3. Signaling Pathway Analysis: Exploring downstream effects of Frizzled activation

  4. Antibody Production: Generating specific antibodies for immunological detection

  5. Genetic Screening: Identifying genetic modifiers of Frizzled function in development

  6. Pharmaceutical Research: Developing compounds that modulate Wnt signaling for therapeutic applications

Genetic Screening Approaches

Novel genetic screening methodologies have expanded our understanding of Frizzled function. A screening approach based on an unexpected mild Frizzled gain-of-function phenotype has identified multiple genomic regions that interact with Frizzled . Using this approach, researchers have discovered new loci with potential functions in the PCP context, including genes related to actin and microtubule dynamics such as krasavietz and short-stop .

Regulatory Mechanisms

Recent studies have identified proteins that regulate Frizzled stability and function. For example, Prickle has been found to have a dual function in regulating Frizzled stability during feedback-dependent amplification of planar polarity . These findings highlight the complex regulatory networks governing Frizzled-mediated signaling in developmental contexts.

Evolutionary Conservation

The Frizzled receptor family demonstrates remarkable evolutionary conservation across species, with similar structural elements and functional domains. This conservation underscores the fundamental importance of these receptors in developmental processes and suggests that findings from Drosophila studies may have broader implications for understanding Frizzled function in other organisms, including humans .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
fz; CG17697; Frizzled; Frizzled-1; dFz1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-581
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
fz
Target Protein Sequence
YDQSPLDASPYYRSGGGLMASSGTELDGLPHHNRCEPITISICKNIPYNMTIMPNLIGHT KQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILERPIPPCRSLCESARVCEKLM KTYNFNWPENLECSKFPVHGGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQTGVESPH RNIGFVCPVQLKTPLGMGYELKVGGKDLHDCGAPCHAMFFPERERTVLRYWVGSWAAVCV ASCLFTVLTFLIDSSRFRYPERAIVFLAVCYLVVGCAYVAGLGAGDSVSCREPFPPPVKL GRLQMMSTITQGHRQTTSCTVLFMALYFCCMAAFAWWSCLAFAWFLAAGLKWGHEAIENK SHLFHLVAWAVPALQTISVLALAKVEGDILSGVCFVGQLDTHSLGAFLILPLCIYLSIGA LFLLAGFISLFRIRTVMKTDGKRTDKLERLMLRIGFFSGLFILPAVGLLGCLFYEYYNFD EWMIQWHRDICKPFSIPCPAARAPGSPEARPIFQIFMVKYLCSMLVGVTSSVWLYSSKTM VSWRNFVERLQGKEPRTRAQAYV
Uniprot No.

Target Background

Function

Recombinant Drosophila melanogaster Frizzled (fz) is a receptor for Wnt proteins. Most Frizzled receptors are coupled to the canonical beta-catenin signaling pathway. This pathway activates dishevelled proteins, inhibits GSK-3 kinase, promotes nuclear accumulation of beta-catenin, and ultimately activates Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been observed in some family members; however, its relationship to the canonical pathway remains unclear, although PKC appears necessary for Wnt-mediated inactivation of GSK-3 kinase. Both pathways involve interactions with G-proteins. Frizzled is also crucial for coordinating the cytoskeletons of epidermal cells to form the parallel arrangement of cuticular hairs and bristles.

Gene References Into Functions
  1. Prickle's stabilizing effect on Frizzled requires Prickle activity in neighboring cells, while Prickle within the same cell destabilizes Frizzled. PMID: 28918952
  2. Frizzled-Planar cell polarity (Fz/PCP) signaling plays an instructive role in polarized centriole positioning in Drosophila wings. PMID: 27021213
  3. Frizzled (Fz) undergoes constitutive ubiquitination and internalization to the early endosome. PMID: 22825661
  4. The Fz C-terminal tail downstream of the KTxxxW motif is not essential for planar polarity or canonical Wnt signaling. PMID: 23023003
  5. Research focuses on elucidating the molecular mechanisms mediating Frizzled's function in planar cell polarity. PMID: 22949620
  6. Frazzled is expressed and cell-autonomously required in R8 photoreceptors to guide their axons to the medulla-neuropil layer M3. PMID: 22794263
  7. Frizzled and Dishevelled are enriched at distal cell sides, localizing at the interface with ligand-expressing cells in non-responding cells. PMID: 22736244
  8. Precise specification of a single R3 cell per ommatidium is crucial for proper interpretation of the Fz-mediated polarity signal. PMID: 9651479
  9. Frizzled is involved in positional information signaling during development, coordinating ommatidia orientation in the Drosophila eye. PMID: 11893338
  10. Frizzled function depends on inturned and fuzzy proteins. PMID: 11973308
  11. Pk influences the asymmetric cytoplasmic localization of fz in Drosophila. PMID: 12015986
  12. Dachsous and Fat act upstream of frizzled in regulating ommatidia orientation. PMID: 12062069
  13. Genetic interactions and epistasis analysis suggest that frizzled, dishevelled, and fat cooperate in long-range propagation of polarity signals in the eye and wing. PMID: 12479810
  14. Dishevelled (Dvl)-binding peptides of Frizzled inhibited canonical Wnt signaling and blocked Wnt-induced secondary axis formation in a dose-dependent manner, without affecting noncanonical Wnt signaling. PMID: 14636582
  15. The dPatj/aPKC complex regulates PCP by inhibiting Fz1 in cells where it shouldn't be active. PMID: 15907474
  16. Frizzled signaling is enhanced by Diego's binding to Dishevelled. PMID: 15937478
  17. Drosophila frizzled controls planar cell polarity and Armadillo signaling through a shared mechanism. PMID: 16085697
  18. Fz activates signaling in two steps: Fz's cysteine-rich domain captures Wingless, and bound Wg interacts with the membrane portion of the receptor to initiate signaling. PMID: 16163385
  19. Wing cells acquire planar polarity along the proximal-distal axis, with Frizzled localizing distally. PMID: 16459300
  20. Drosophila planar cell polarity is hierarchically controlled by Frizzled (Fz), a serpentine receptor also functioning in the Wnt signaling pathway. PMID: 17102631
  21. Research examined Diego's (Dgo) role, a Dsh-binding PCP molecule, in both Wnt-Fz/beta-catenin and Fz/PCP signaling. PMID: 18065209
Database Links

KEGG: dme:Dmel_CG17697

STRING: 7227.FBpp0303135

UniGene: Dm.1456

Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Frizzled in Drosophila development?

Frizzled (fz) in Drosophila melanogaster serves dual critical functions in development: it controls planar cell polarization (PCP) of epithelia and regulates cell fate decisions through the Armadillo (Arm) pathway by acting as a receptor for the Wnt protein Wingless (Wg) . In fz mutants, the parallel array of hairs and bristles that decorate the cuticle is disrupted, demonstrating its essential role in tissue polarity development . The importance of Frizzled becomes evident in embryonic development, where mutants lacking maternal frizzled and zygotic frizzled and Dfrizzled2 exhibit defects in the embryonic epidermis, CNS, heart, and midgut that mirror those observed in wingless mutants .

How do researchers distinguish between cell-autonomous and non-autonomous Frizzled functions?

Cell-autonomous and non-autonomous functions of Frizzled can be distinguished through careful genetic analysis of different alleles. In extensive studies of multiple fz alleles, researchers found that 15 of 19 examined alleles display cell non-autonomy . Further molecular analysis revealed that cell-autonomous mutations were specifically associated with alterations in a proline residue located in the presumptive first cytoplasmic loop of the protein, while non-autonomous mutations affected amino acids throughout the Frizzled protein . This distinction has significant implications for understanding how Frizzled participates in both local and long-range signaling events during development.

Frizzled Mutation TypeAffected Protein RegionFunctional ImpactReference
Cell-autonomousProline residue in first cytoplasmic loopAffects local signaling
Cell non-autonomousVarious regions throughout proteinAffects signal propagation

What are the conserved structural features of Frizzled proteins?

Frizzled proteins are remarkably conserved across species. Comparative studies between D. melanogaster and D. virilis reveal that their Frizzled proteins are unusually well conserved, with identical sequences in the putative cytoplasmic domains . This high degree of conservation indicates strong evolutionary pressure to maintain specific structural elements essential for Frizzled function. The protein contains seven putative transmembrane domains characteristic of this receptor family, with key functional regions including the extracellular Wnt-binding domain and intracellular regions that interact with downstream signaling components such as Dishevelled .

How do Frizzled receptors differentiate between canonical and non-canonical signaling pathways?

The molecular mechanism by which Frizzled differentiates between canonical Wnt and non-canonical PCP signaling has been a subject of intensive research. Evidence suggests qualitatively different Frizzled-Dishevelled interactions underlie these distinct pathways . Structure-function dissection studies have identified missense mutations in cytosolic-facing regions of the Frizzled receptor that block Dishevelled recruitment . Interestingly, while some of these mutations affect both planar polarity and canonical activity, a subset specifically impacts only planar polarity function . This selective effect suggests pathway-specific structural requirements for Frizzled-Dishevelled interactions.

The PDZ domain of Dishevelled provides further insight into pathway differentiation. While deletion of this domain in Drosophila dishevelled mutants leaves canonical Wingless signaling entirely normal, these mutants show defects in multiple contexts controlled by noncanonical Wnt signaling, such as planar polarity . Nuclear magnetic resonance spectroscopy has identified bona fide PDZ-binding motifs at the C-termini of different polarity proteins, suggesting a specific molecular basis for pathway selection .

What is the significance of Frizzled protein asymmetry in polarized cells?

Research has revealed intracellular asymmetry in the distribution of Frizzled protein within polarized cells. Quantitative measurements show that the posterior membrane of each cell carries approximately 22% more Frizzled than the anterior membrane . This asymmetric distribution is critical for establishing and maintaining planar cell polarity. The molecular mechanisms that establish this asymmetry involve complex interactions with other PCP pathway components and cytoskeletal elements. Understanding how this asymmetry is established and maintained provides insight into the fundamental processes of cell and tissue polarization.

How do Frizzled and DFrizzled2 function redundantly in Wingless signaling?

Genetic analysis demonstrates that Frizzled and DFrizzled2 function as redundant receptors for Wingless during Drosophila embryonic development . Mutants lacking maternal frizzled and zygotic frizzled and Dfrizzled2 exhibit defects indistinguishable from those observed in wingless mutants, affecting the embryonic epidermis, CNS, heart, and midgut . Epidermal patterning defects in frizzled, Dfrizzled2 double-mutant embryos can be rescued by ectopic expression of either gene, confirming their functional redundancy .

Epistasis experiments position frizzled and Dfrizzled2 function downstream of wingless and upstream of armadillo. In frizzled, Dfrizzled2 mutant embryos, ectopic production of Wingless does not alter the epidermal patterning defect, whereas ectopic production of an activated form of Armadillo produces the expected naked cuticle phenotype . The lack of effect from ectopic Wingless in these double mutants argues against the existence of additional Wingless receptors in the embryo or models in which Frizzled proteins simply present ligands to other receptors .

What molecular approaches can identify critical amino acids required for specific Frizzled functions?

Researchers have employed several sophisticated approaches to identify specific amino acids required for distinct Frizzled functions:

  • Allele-specific phenotypic quantification: For each frizzled allele, quantifying signaling strength through specific phenotypic measurements. For PCP signaling, this includes counting cells secreting multiple hairs in the wing, while Arm signaling capacity is assessed by the ability to rescue fz mutant embryos with maternally provided fz .

  • Structure-function dissection through mutagenesis: Large-scale mutagenesis to isolate novel mutations in frizzled that affect planar polarity activity has identified missense mutations in cytosolic-facing regions that block Dishevelled recruitment .

  • Comparative sequence analysis: Comparing Frizzled sequences across species (such as between D. melanogaster and D. virilis) reveals unusually well-conserved regions likely critical for function .

  • Epistasis analysis: Positioning Frizzled function within signaling pathways through genetic interaction studies with upstream and downstream components .

What are effective approaches for studying Frizzled-Dishevelled interactions?

Several methodological approaches have proven effective for studying Frizzled-Dishevelled interactions:

  • Membrane recruitment assays: Ectopic expression of rat frizzled-1 (Rfz-1) demonstrably recruits the dishevelled protein to the plasma membrane, providing a visual readout of interaction .

  • Nuclear magnetic resonance spectroscopy: This technique has successfully identified bona fide PDZ-binding motifs at the C-termini of different polarity proteins that interact with Dishevelled's PDZ domain .

  • Genetic screens: Using mild Frizzled gain-of-function phenotypes as a background for genetic screens has successfully identified interacting genomic regions. For example, screening a genome-wide collection of large deficiencies using a leaky chimeric Frizzled protein designed to accumulate in the endoplasmic reticulum identified 16 strongly interacting genomic regions .

  • Structure-function dissection: Targeted mutagenesis of specific domains followed by functional assays has identified regions of Frizzled required for Dishevelled binding .

How can researchers effectively generate and characterize recombinant Frizzled proteins?

Generating functional recombinant Frizzled proteins requires careful consideration of their seven-transmembrane structure and post-translational modifications. Successful approaches include:

  • Expression system selection: Membrane proteins like Frizzled often require eukaryotic expression systems that can properly fold and modify these complex proteins. Drosophila S2 cells have proven effective for expressing Frizzled proteins in a native-like context .

  • Protein solubilization and purification: Due to their transmembrane nature, Frizzled proteins require detergent solubilization for biochemical studies. The choice of detergent is critical for maintaining protein stability and function.

  • Functional validation: Western blot analysis can verify protein expression and identify alterations in protein migration patterns. Many fz mutations result in altered amounts of Fz protein and aberrant migration in SDS-PAGE, providing insights into structural changes .

  • Chimeric constructs: Creating chimeric Frizzled proteins with tags or fusion partners has facilitated studies of protein localization and function. For example, a chimeric Frizzled protein designed to accumulate in the endoplasmic reticulum generates a reproducible gain-of-function phenotype useful for genetic screens .

What genetic screening approaches can identify new components of Frizzled signaling pathways?

Several genetic screening strategies have proven effective:

  • Screens under Frizzled overexpression conditions: Although Fz-PCP signaling is sensitive to increased doses of PCP gene products, screens in the wing under genetically engineered Fz over-expression conditions have been challenging because the phenotypes are strong or difficult to score. A breakthrough approach used a leaky chimeric Frizzled protein that accumulates in the endoplasmic reticulum to generate a reproducible gain-of-function phenotype for screening .

  • EMS mutagenesis for allele generation: Chemical mutagenesis with ethyl methanesulfonate (EMS) has successfully generated frizzled mutations affecting various aspects of signaling .

  • Deficiency screening: Using a genome-wide collection of large deficiencies, researchers identified 16 strongly interacting genomic regions, which were further narrowed to 116 candidate genes .

  • Double-mutant analysis: Creating double mutants lacking both maternal frizzled and zygotic frizzled and Dfrizzled2 revealed functional redundancy that would have been missed in single-gene approaches .

How should researchers interpret contradictory results regarding Frizzled-Dishevelled interactions?

The literature shows apparent contradictions regarding Frizzled-Dishevelled interactions in different signaling pathways. Some studies of mutated Dishevelled forms suggest stable recruitment of Dishevelled to membranes by Frizzled is required only for planar polarity activity, implying qualitatively different Frizzled-Dishevelled interactions underlie canonical signaling . Conversely, studies of sequence requirements for Frizzled receptors in Drosophila for canonical and planar polarity signaling have concluded there is likely a common mechanism of action .

To reconcile these contradictions, researchers should:

  • Consider pathway-specific cofactors that may modify basic Frizzled-Dishevelled interactions

  • Examine context-dependent effects based on cell type or developmental stage

  • Analyze differences in experimental approaches, including overexpression versus loss-of-function studies

  • Study the impact of protein dynamics and transient versus stable interactions

The identification of missense mutations that affect only planar polarity but not canonical activity supports the view that qualitatively different Frizzled-Dishevelled interactions underlie these pathways .

What explains the differential requirement for Dishevelled domains in distinct Frizzled signaling pathways?

The differential requirement for Dishevelled domains provides insight into pathway specificity. While the PDZ domain of Dishevelled appears dispensable for canonical Wingless signaling (as PDZ domain deletion mutants show normal canonical signaling), this domain is critical for noncanonical Wnt signaling in planar polarity contexts .

This differential requirement likely reflects distinct molecular mechanisms:

  • In canonical signaling, the DIX domain of Dishevelled facilitates polymerization to assemble dynamic signalosomes, which may be the primary mechanism for signal transduction .

  • In noncanonical signaling, the PDZ domain interacts with specific binding motifs at the C-termini of polarity proteins, facilitating pathway-specific protein complexes .

  • The DEP domain of Dishevelled binds to the intracellular face of Frizzled and may contribute to pathway specificity through conformation-dependent interactions .

Understanding these differential domain requirements helps explain how a single receptor family can specify distinct signaling outcomes in different developmental contexts.

What are emerging approaches for studying dynamic Frizzled-Wnt interactions in vivo?

Current cutting-edge approaches include:

  • Live imaging techniques: Advanced microscopy methods allow visualization of Frizzled trafficking and localization in real-time within developing tissues.

  • Optogenetic control: Light-activated protein domains fused to Frizzled components enable precise spatial and temporal control of signaling activity.

  • CRISPR-based genome editing: Precise modification of endogenous frizzled genes to introduce specific mutations or fluorescent tags without disrupting normal expression patterns.

  • Single-cell analysis: Examining Frizzled expression and activity at the single-cell level reveals heterogeneity in signaling responses within tissues.

  • Cryo-electron microscopy: Structural studies of Frizzled-ligand complexes provide atomic-level insights into binding and activation mechanisms.

These approaches are advancing our understanding of the dynamic nature of Frizzled signaling in developing tissues.

How can researchers effectively model the functional redundancy between Frizzled family members?

Effective strategies for modeling functional redundancy include:

  • Generation of double and triple mutants: Creating animals lacking multiple Frizzled family members has revealed redundant functions that would be missed in single mutant studies .

  • Tissue-specific knockdown: Using RNAi or CRISPR approaches to reduce expression of multiple Frizzled proteins in specific tissues can bypass early lethality issues.

  • Rescue experiments: Testing the ability of different Frizzled family members to rescue mutant phenotypes provides insight into functional overlap. For example, epidermal patterning defects in frizzled, Dfrizzled2 double-mutant embryos can be rescued by ectopic expression of either gene .

  • Domain-swapping experiments: Creating chimeric receptors with domains from different Frizzled family members helps identify regions responsible for specific functions versus regions that provide general Frizzled activity.

  • Quantitative analysis of signaling output: Measuring pathway activation levels in response to different combinations of Frizzled proteins can reveal additive, synergistic, or redundant relationships.

Understanding redundancy is crucial for fully elucidating Frizzled functions in development and disease contexts.

What approaches can identify novel components of Frizzled signaling pathways?

Innovative approaches for identifying new pathway components include:

  • Genetic modifier screens: Using sensitized genetic backgrounds (such as mild Frizzled gain-of-function phenotypes) to identify enhancers and suppressors .

  • Proteomic analysis: Mass spectrometry-based identification of proteins that interact with different domains of Frizzled or Dishevelled under various signaling conditions.

  • Comparative genomics: Identifying conserved regulatory elements in frizzled gene loci across species can reveal new transcriptional regulators.

  • CRISPR screens: Genome-wide or targeted CRISPR-Cas9 screens in Drosophila cells or embryos can identify genes affecting Frizzled-dependent processes.

  • Network analysis: Computational approaches that integrate multiple datasets (transcriptomics, proteomics, genetic interactions) to predict new pathway components.

These approaches continue to expand our understanding of the complex signaling networks in which Frizzled proteins function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.