Recombinant Drosophila melanogaster G-protein coupled receptor moody (moody)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Moody GPCR

Recombinant Drosophila melanogaster G-protein coupled receptor moody (moody) is a laboratory-produced form of the native Moody protein found in fruit flies. The moody gene encodes a G-protein coupled receptor that belongs to the class A (rhodopsin-like) group of GPCRs . The recombinant form of this protein has been developed to facilitate research into the structure and function of this critical signaling molecule.

Commercially available as a partial recombinant protein preparation, this molecule enables researchers to investigate receptor-ligand interactions, signaling pathways, and other molecular mechanisms without the complexity of working with intact organisms . The protein is typically supplied in quantities of approximately 50 μg in optimized buffer conditions to maintain stability and functionality .

Protein Structure and Topology

As a member of the GPCR superfamily, Moody possesses the characteristic seven-transmembrane (7TM) domain structure. Detailed structural analysis reveals that Moody belongs to the rhodopsin-like family of GPCRs, which is the largest and most diverse GPCR family . The protein contains:

  1. An extracellular N-terminal domain

  2. Seven transmembrane alpha-helical domains

  3. Three extracellular loops (ECLs)

  4. Three intracellular loops (ICLs)

  5. An intracellular C-terminal domain

The recombinant protein is typically tagged to facilitate purification and detection, though the specific tag type may vary depending on the production process .

Biological Function of Native Moody GPCR

Understanding the biological context of the native Moody protein illuminates the significance of its recombinant counterpart for research applications.

Role in Blood-Brain Barrier Formation and Maintenance

The Moody GPCR plays a critical role in the formation and maintenance of the blood-brain barrier (BBB) in Drosophila melanogaster. The BBB comprises a thin epithelial layer of subperineural glia (SPG) that insulate the nerve cord against the potassium-rich hemolymph by forming intercellular septate junctions (SJs) .

Studies have demonstrated that Moody signaling is essential for:

  • Initial BBB formation at the embryonic stage

  • Continued subperineural glia (SPG) growth

  • BBB maintenance during larval and adult stages

Loss of Moody function results in compromised septate junctions and BBB permeability defects, highlighting its essential role in maintaining neural insulation .

Signaling Mechanisms

Moody functions as a canonical G protein-coupled receptor, signaling through heterotrimeric G proteins. Key findings regarding its signaling mechanisms include:

  1. PKA as a Key Effector: cAMP-dependent protein kinase A (PKA) has been identified as a crucial antagonistic Moody effector that mediates BBB formation and maintenance .

  2. Polarized Signaling: PKA is enriched at the basal side of the SPG cell, and this polarized activity of the Moody/PKA pathway finely tunes cell growth and BBB integrity .

  3. Regulation of Cytoskeletal Dynamics: Moody/PKA signaling precisely regulates actomyosin contractility, vesicle trafficking, and proper septate junction organization .

  4. Downstream Targets: The effects of Moody signaling are mediated in part by PKA's molecular targets, including myosin light chain kinase (MLCK) and Rho1 .

  5. Actin-Rich Structures: Moody signaling regulates the formation of specialized actin-rich structures (ARSs) that dynamically form along the lateral borders of the SPG cells, contributing to BBB maintenance .

Other Biological Functions

Recent research has uncovered additional roles for the Moody GPCR:

  1. Germline Stem Cell Maintenance: RNAi-based screens suggest that Moody may be required in somatic cells for normal egg production and proper germline stem cell maintenance in Drosophila females .

  2. Phylogenetic Significance: Moody is homologous to mammalian melatonin receptors, suggesting evolutionary conservation of certain signaling mechanisms .

The following table summarizes the key biological functions of the Moody GPCR:

FunctionMechanismConsequences of DisruptionReferences
Blood-Brain Barrier FormationRegulation of septate junction formation in subperineural gliaBBB permeability defects, insulation failure
Blood-Brain Barrier MaintenanceControl of actomyosin contractility and actin-rich structuresCompromised neural insulation during growth
Cell Growth RegulationMoody/PKA signaling pathwayAbnormal SPG cell growth
Germline Stem Cell MaintenanceMechanism not fully characterizedReduced egg production

Expression and Purification

The recombinant Drosophila Moody protein is typically produced using heterologous expression systems. The protein is supplied in optimized buffer conditions, generally consisting of a Tris-based buffer with 50% glycerol to maintain stability . The specific expression and purification methods may vary among commercial suppliers, but generally involve:

  1. Gene cloning into an appropriate expression vector

  2. Transformation into a suitable host (bacterial, insect, or mammalian cells)

  3. Induction of protein expression

  4. Cell lysis and extraction

  5. Affinity purification using protein tags

  6. Quality control testing

Investigating Blood-Brain Barrier Formation

The recombinant Moody protein serves as a valuable tool for studying the molecular mechanisms of blood-brain barrier formation and maintenance. Researchers utilize this protein to:

  1. Analyze protein-protein interactions with other BBB components

  2. Study the binding specificity and affinity of potential ligands

  3. Generate antibodies for immunolocalization studies

  4. Investigate structure-function relationships through mutagenesis studies

GPCR Signaling Research

As a member of the GPCR superfamily, recombinant Moody provides insights into the general mechanisms of GPCR signaling:

  1. Comparison with other GPCRs in the phylogenetic tree reveals evolutionary relationships and potential functional conservation

  2. Structure-based studies illuminate the basic principles of receptor activation and signal transduction

  3. Investigation of G-protein coupling specificity enhances understanding of downstream pathway selectivity

Comparative Studies with Other Receptors

The recombinant Moody protein facilitates comparative analyses with other related receptors:

  1. Comparison with Tre1: Both Moody and Tre1 are GPCRs in Drosophila that regulate distinct biological processes. While Moody controls BBB integrity, Tre1 directs germ cell migration . Comparing their structures and signaling mechanisms provides insights into receptor specialization.

  2. Comparison with Frizzled: Both belong to the GPCR superfamily but have distinct signaling mechanisms. Frizzled functions in Wnt signaling through mechanisms that appear to rely more on receptor heterodimerization than the allosteric mechanisms seen in other GPCRs .

Future Research Directions

The development and characterization of recombinant Drosophila Moody protein opens several promising avenues for future research:

  1. Identifying the Endogenous Ligand: Moody remains an orphan receptor with an unidentified natural ligand. The recombinant protein could facilitate ligand screening and identification studies .

  2. Structural Studies: High-resolution structural determination of the Moody GPCR would enhance understanding of its activation mechanisms and facilitate structure-based drug design.

  3. Therapeutic Applications: Understanding the mechanisms of BBB formation through Moody signaling could inform approaches to modulate the human BBB for drug delivery or to address BBB dysfunction in neurological disorders.

  4. Evolutionary Biology: Comparative studies between Drosophila Moody and its mammalian homologs (melatonin receptors) could illuminate the evolution of neural barrier systems across species .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us for preferential development.
Synonyms
moody; CG4322; G-protein coupled receptor moody
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-670
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
moody
Target Protein Sequence
MSDETTISLEDGYPPLEALTTMVPPADATGFSQSLLTFAAVMTFLIMIVGICGNLLTVVA LLKCPKVRNVAAAFIISLCIADLLFCALVLPFQGLRFVQGTWRHGQVLCRLIPFIQYGNI GVSLLCIAMITINRYVMITHHGLYARIYKRHWIAVMIAACWLFSYGMQLPTLLGEWGRFG YDSRLQTCSIMTDDHGHSSKTTLFITAFVIPCLVIIACYAKIFWVVHKSEQRLKRHATKQ NSIPNNLRPLASTGSGALPSGAECQPSNRVSSDSSSSFSIDVPETAPSGKQQPTRVKDQR EVRAKRNEWRITKMVLAIFLSFVVCYLPITIVKVADKNVEHPSLHICSYILLYLSACINP IIYVIMNKQYRKAYKTVVFCQPARLLLPFGKTNGASSAAEKWKDTGLSNNHSRTIVSQMS GGTGAASGAGTATGTAAVAVMQTPPEVQQAQALEMVSRGPDLISKSNLPQPNVTPPPPSV LTATPNGSNSNSLTLRLPLKKNNHCYTNSGFNSSTPSPSSGLGIGISSSSIYRPGVGSLG SGSASIRRITMVGDDIILEEEELPPTPPATSAPTTPAPPPPSSPLHPLSTDSSTTTISGG AVVAGSSAPKPATPTPHIYMNVDSPKRNQYYMDRNTNAVAPESDSGPANTSATVSISGSK LTAKMKFPKD
Uniprot No.

Target Background

Function
Isoforms A and B of the *moody* receptor are essential in glial cells for regulating acute cocaine sensitivity and maintaining blood-brain barrier (BBB) function. A Moody-mediated signaling pathway regulates nervous system insulation and drug-related behaviors within glia. Gαi, Gαo, and the regulator of G protein signaling, Loco, are necessary in surface glia for effective insulation. These components function by regulating cortical actin, thereby stabilizing the extended morphology of surface glia, which is crucial for forming septate junctions of sufficient length to properly seal the nerve cord.
Gene References Into Functions
  1. This study suggests a mechanism by which the Drosophila BBB is maintained through Moody/GPCR-dependent formation of adherens junctions (AJs), supported by myosin activation. PMID: 21242289
Database Links

KEGG: dme:Dmel_CG4322

STRING: 7227.FBpp0292162

UniGene: Dm.12246

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform A and isoform B are expressed in the head. Isoform B only is expressed in the body. Expressed in embryonic glial cells that are involved in ensheathment and insulation of the nervous system. Both isoforms are expressed in glia that insulate the la

Q&A

What are the key structural characteristics of Moody GPCR in Drosophila melanogaster?

Moody is a Rhodopsin-family GPCR encoded by the moody gene that produces two isoforms through alternative splicing: Moody-α and Moody-β. Both proteins share identical membrane-spanning domains but differ significantly in their carboxy-terminal cytoplasmic domains, which are generated by use of alternative reading frames. The receptor contains the characteristic seven-transmembrane structure of GPCRs with specific residues such as asparagine, tryptophan, and proline that stabilize the transmembrane domains. Moody is expressed on the basal, brain-facing surface of the subperineurial glia (SPG) in the blood-brain barrier .

How do the two Moody isoforms (Moody-α and Moody-β) differ functionally?

While either Moody-α or Moody-β isoform is sufficient for basic blood-brain barrier formation and structural integrity, both isoforms are required simultaneously for more complex functions including proper behavioral responses (such as normal courtship behavior and drug sensitivity). RNA sequencing data suggests the two isoforms are not present in equal abundance, and their ratio appears to be sex-specifically regulated. The difference in their intracellular domains suggests they interact with different downstream effector molecules, both contributing to behavioral responses, though through potentially distinct signaling mechanisms . Neither isoform can fully compensate for the absence of the other in behavioral contexts, indicating complementary but non-redundant functions .

What is known about the ligand(s) for Moody GPCR?

Moody is currently classified as an orphan GPCR, meaning its endogenous ligand(s) remain unidentified. This represents a significant gap in our understanding of Moody signaling. Given Moody's expression on the neuronal-facing surface of the subperineurial glia, it's hypothesized that the ligand may be a neuron-derived signaling molecule that communicates neuronal states (e.g., related to sleep) to the BBB glia. Identifying Moody's ligand(s) remains an important research priority that would help elucidate how the receptor is activated in different physiological contexts .

What are the established genetic approaches for studying Moody function in Drosophila?

Several genetic approaches have been validated for studying Moody function:

Loss-of-function approaches:

  • moodyΔ17 null mutants (typically lethal with few adult escapers)

  • Conditional knockdown using RNAi with moody-Gal4 or SPG-Gal4 drivers

  • Temperature-sensitive Gal80ts system for temporal control of knockdown in adults

  • Tissue-specific knockdown using repo-GeneSwitch for induction with RU486

Rescue experiments:

  • moodyΔ17; moody-α or moodyΔ17; moody-β flies to study isoform-specific functions

  • Combination of both transgenes to restore normal function

Functional manipulation:

  • Sex-specific feminization of the BBB using TraF expression

  • Pertussis toxin (PTX) expression to inhibit Go signaling

  • Expression of constitutively active or dominant-negative G-protein subunits

What assays are used to measure BBB integrity in Moody studies?

Several complementary approaches are used to assess BBB integrity:

Dye penetration assay:

  • Injection of fluorescent dyes (typically 10 kDa dextran dyes) into the hemolymph

  • Quantification of dye penetration into the central nervous system

  • Time-course imaging to measure barrier dynamics

Electrical resistance measurements:

  • Recording transepithelial resistance across the BBB

Molecular marker analysis:

  • Immunostaining for septate junction components

  • Assessment of septate junction continuity and organization

Ultrastructural analysis:

  • Electron microscopy to examine septate junction ultrastructure

  • 3D reconstruction to measure continuity of individual septate junction segments

For adult studies, dye injection is typically performed in the abdomen, while in larvae, dye can be introduced through body wall puncture. Quantification involves measuring fluorescence intensity in the CNS relative to the surrounding tissue .

How can one effectively express and characterize recombinant Moody protein for in vitro studies?

For recombinant expression and characterization of Moody:

Expression systems:

  • Drosophila S2 cells provide a native-like environment with appropriate post-translational modifications

  • High Five insect cells yield higher protein levels

  • HEK293 cells can be used with codon optimization

Protein purification approach:

  • Add epitope tags (His6, FLAG, or HA) to either N-terminus (after signal sequence) or C-terminus

  • Use detergent screening (typically DDM, LMNG, or GDN) for membrane extraction

  • Employ affinity chromatography followed by size exclusion chromatography

  • Verify protein quality by SDS-PAGE and Western blotting with isoform-specific antibodies

Functional characterization:

  • GTPγS binding assays to measure G-protein activation

  • BRET/FRET assays to study protein-protein interactions

  • Calcium mobilization assays if coupled to Gq proteins

  • Surface plasmon resonance for potential ligand screening

The choice of tag position is critical as C-terminal tagging may interfere differently with the two isoforms due to their distinct C-terminal domains .

How does Moody signaling regulate blood-brain barrier formation and maintenance?

Moody regulates BBB through multiple coordinated mechanisms:

Development and formation:

  • PKA activation by Moody signaling controls the developmental assembly of septate junction belts

  • Coordinates spatiotemporal rearrangements of the actin cytoskeleton

  • Regulates vesicular trafficking of septate junction components

  • Influences cell shape and polarized cell function

Maintenance in adults:

  • Continuous signaling required for BBB integrity

  • Formation of actin-rich structures (ARSs) along lateral SPG borders

  • Regulation of myosin activation and actomyosin contractility

  • Control of specialized glia growth during larval and adult stages

Molecular targets:

  • MLCK (Myosin Light Chain Kinase) and Rho1 are direct targets of PKA downstream of Moody

  • Proper organization of septate junctions depends on continuity of individual segments rather than total length

The dual-isoform requirement suggests that Moody-α and Moody-β may regulate different aspects of this process, potentially through differential engagement of downstream effectors .

What is the role of Moody in regulating courtship behavior and how does it differ between sexes?

Moody functions in a sex-specific manner to regulate courtship:

Male-specific functions:

  • Male identity of the BBB is necessary for normal male courtship behavior

  • Feminization of the BBB in otherwise normal males significantly reduces courtship index

  • Both Moody-α and Moody-β isoforms are required for normal courtship

  • The ratio of Moody isoforms appears to be regulated by the sex-specific splicing factor TraF

Signaling mechanisms:

  • Go signaling downstream of Moody is required for courtship

  • Potential interaction with dopamine receptor D2R, which is also expressed in BBB and required for male courtship

  • Sex-specific molecules in the BBB likely interact with Moody signaling

Experimental evidence:

  • Adult-specific feminization of the BBB reduces male courtship, indicating an active physiological role rather than developmental

  • Conditional manipulation of Go signaling in adults affects courtship

  • The BBB integrity remains intact during these manipulations, suggesting specific signaling roles

This suggests that the BBB serves as an interface between circulating factors and the sex-specific neural circuits controlling courtship, with Moody as a key mediator of this interaction .

How does Moody signaling interact with sleep regulation in Drosophila?

Moody plays a central role in sleep regulation through BBB modulation:

Sleep-wake cycle effects:

  • Sleep deprivation rapidly depresses moody expression

  • moody levels are 60-90% lower in sleep mutant flies

  • Adult-specific knockdown of moody in the BBB causes sleep loss

  • Sleep fragmentation occurs with increased BBB permeability

Bidirectional relationship:

  • BBB permeability increases in a dose-dependent manner with sleep deprivation

  • BBB closes rapidly when sleep is recovered

  • Permeability changes are dynamic and reversible

  • Sleep recovery restores moody expression levels

Downstream effects:

  • Altered BBB permeability may allow passage of sleep-regulating molecules

  • Changes in BBB permeability potentially affect ionic homeostasis

  • Moody signaling through PKA may regulate endocytosis at the BBB during sleep/wake cycles

This suggests a model where neuronal activation during wakefulness affects Moody signaling to increase BBB permeability, which may itself be part of the sleep regulatory mechanism .

How can conflicting results between different Moody signaling mutants be reconciled?

Researchers often encounter seemingly contradictory results when studying Moody signaling components. Several methodological approaches can help reconcile these conflicts:

Address genetic background effects:

  • Compare mutants after backcrossing to identical genetic backgrounds (minimum 5-10 generations)

  • Use precise genetic controls with the same insertions but lacking the mutation/RNAi construct

  • Employ CRISPR/Cas9 to generate mutations on identical backgrounds

Consider dosage-dependent effects:

  • Different protein levels from hypomorphic alleles versus complete knockouts

  • Partial compensation by related genes at different expression levels

  • Quantify protein levels by Western blot to correlate with phenotypic severity

Examine timing-dependent effects:

  • Use temperature-sensitive systems to manipulate gene expression at different developmental stages

  • Compare acute versus chronic manipulations

  • Consider potential developmental compensation versus acute requirements

Example resolution approach:
For conflicting results in moody loco double mutants (where genomic double mutants show worse insulation defects than loco alone, while RNAi double mutants resemble moody alone), carefully quantify remaining protein levels and determine whether threshold effects exist where certain phenotypes manifest only below specific protein concentrations .

What approaches can identify the unknown ligand for Moody GPCR?

Identifying Moody's ligand(s) requires a multi-faceted strategy:

Candidate molecule screening:

  • Test neuropeptides and small molecules expressed in neurons adjacent to the BBB

  • Screen fractionated Drosophila brain extracts using functional assays

  • Examine molecules upregulated during processes requiring active Moody signaling (sleep deprivation, courtship)

Cell-based screening system:

  • Express Moody in heterologous cells with biosensors (calcium indicators, cAMP reporters)

  • Design assays for Go/Gi coupling (measuring cAMP inhibition)

  • Develop BRET/FRET-based assays to monitor conformational changes upon ligand binding

  • Screen compound libraries and tissue extracts

Bioinformatic approaches:

  • Sequence comparison with related GPCRs that have known ligands

  • Machine learning predictions based on binding pocket characteristics

  • Molecular docking simulations with candidate ligands

Unbiased genetic screens:

  • Screen for mutations affecting Moody-dependent phenotypes

  • Identify genetic suppressors of moody mutant phenotypes

  • Use proximity labeling (BioID/TurboID) to identify proteins interacting with Moody in vivo

Combining these approaches with advanced structural biology methods (cryo-EM) could illuminate the molecular recognition properties of Moody .

What are the molecular mechanisms explaining how Moody differentially regulates diverse physiological processes?

The diverse functions of Moody likely involve distinct molecular mechanisms:

Isoform-specific signaling:

  • Design experiments comparing signaling outputs between Moody-α and Moody-β

  • Use phosphoproteomics to identify differential phosphorylation targets

  • Generate chimeric receptors to map domains responsible for specific functions

Spatiotemporal regulation:

  • Develop optogenetic tools to activate Moody signaling in specific subpopulations of glia

  • Employ tissue-specific rescue experiments with subcellular targeting sequences

  • Utilize live imaging with labeled Moody variants to track receptor dynamics

G-protein coupling specificity:

  • Measure G-protein selectivity using BRET/FRET biosensors

  • Identify residues governing G-protein specificity through mutagenesis

  • Analyze the dynamics of receptor-G protein interactions in different contexts

Downstream pathway analysis:

  • Compare transcriptional responses to Moody activation in different contexts

  • Create biosensors for downstream effectors (PKA, Rho1) to measure local activation

  • Employ suppressor/enhancer genetic screens to identify context-specific pathways

A comprehensive approach would combine these methods to create pathway maps for each Moody function, potentially revealing how the same receptor can coordinate distinct physiological processes through differential engagement of signaling components .

How can contradictory effects of Moody on both BBB integrity and behavioral regulation be experimentally dissociated?

To dissociate BBB integrity functions from behavioral regulation:

Structure-function analysis:

  • Generate point mutations that selectively affect G-protein coupling versus BBB integrity

  • Create phosphorylation site mutants to disrupt specific downstream pathways

  • Design domain swaps between Moody and related GPCRs that don't affect behavior

Temporal manipulation approach:

  • Use adult-specific manipulations that don't compromise BBB integrity (verified by dye injection)

  • Employ rapid chemogenetic or optogenetic tools to activate/inhibit signaling without affecting barrier structure

  • Measure both BBB integrity and behavior in the same animals to establish correlations

Pathway-specific interventions:

  • Target specific downstream components (e.g., PKA inhibition) that might selectively affect behavior versus BBB structure

  • Manipulate cytoskeletal regulators downstream of Moody that specifically affect junctions versus signaling

  • Identify behavioral modifiers that don't affect BBB integrity

Example experimental design:
Use a CRISPR-generated mutant that maintains BBB integrity but disrupts G-protein coupling (moody^G-mut^) and compare to wild-type and null alleles across behavioral assays. The data could be presented in a table showing BBB integrity measurements and behavioral outcomes across genotypes:

GenotypeBBB Integrity (Dye Exclusion %)Courtship IndexSleep Duration (min)Drug Response
Wild-type95.3 ± 2.10.72 ± 0.05723 ± 45Baseline
moody^Δ17^23.7 ± 8.40.11 ± 0.03342 ± 38Hypersensitive
moody^G-mut^91.8 ± 3.20.18 ± 0.04385 ± 42Hypersensitive

This would demonstrate that BBB integrity can be uncoupled from behavioral functions, suggesting separable signaling mechanisms .

What methodological approaches can determine if Moody signaling has a conserved role in mammalian BBB function?

To explore evolutionary conservation of Moody functions:

Comparative genomics approach:

  • Identify closest mammalian homologs using sequence analysis and phylogenetics

  • Compare expression patterns in mammalian BBB cells versus other tissues

  • Analyze conservation of key functional domains and signaling motifs

Cross-species functional complementation:

  • Express mammalian homologs in moody mutant flies to test rescue of phenotypes

  • Create knock-in flies with mammalian receptor domains substituted for Moody domains

  • Test if Drosophila Moody can function in mammalian BBB cell culture models

Translational research approaches:

  • Examine mammalian homolog expression changes during sleep deprivation

  • Test if drugs affecting Moody in flies have similar effects on mammalian BBB

  • Study mammalian homolog knockout models for BBB phenotypes similar to fly moody mutants

Signaling conservation analysis:

  • Compare downstream signaling pathways between flies and mammals

  • Test if manipulating homologous pathways affects mammalian BBB similarly

  • Employ proteomics to identify conserved interaction partners

This cross-species approach could reveal fundamental mechanisms of BBB regulation conserved from insects to mammals, potentially identifying new therapeutic targets for BBB manipulation in neurological disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.