Recombinant Drosophila melanogaster Gamma-secretase subunit Aph-1 (aph-1)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Overview

Recombinant Drosophila melanogaster Gamma-secretase subunit Aph-1 (aph-1) is a recombinant protein expressed in E. coli as a full-length transmembrane component of the γ-secretase complex. It serves as a Presenilin-stabilization factor critical for γ-secretase assembly and activity. In Drosophila, this protein facilitates the maturation of Presenilin (Psn) into its active N-terminal fragment (NTF)/C-terminal fragment (CTF) heterodimer, enabling intramembranous proteolysis of substrates like Notch and amyloid precursor protein (APP) .

Table 1: Recombinant Aph-1 Protein Properties

ParameterDetails
SourceE. coli in vitro expression system
TagN-terminal 10xHis-tag
Protein LengthFull-length (1–238 amino acids)
SequenceMTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSLWYALIPLKE... (Full sequence in )
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL); add 5–50% glycerol for long-term storage

Presenilin Maturation and γ-Secretase Activity

Aph-1 stabilizes nascent Psn holoprotein, enabling its endoproteolytic cleavage into the active NTF/CTF heterodimer. Studies in Drosophila show that:

  • Psn stabilization: Aph-1 prevents degradation of unprocessed Psn, ensuring proper γ-secretase assembly .

  • Activity regulation: Even with Psn variants lacking endoproteolysis requirements, Aph-1 remains essential for γ-secretase function, indicating a role beyond Psn maturation .

Cell Survival and Proliferation

Aph-1 mutants exhibit defects in wing imaginal disc cell survival, independent of γ-secretase activity. This suggests a secondary role in:

  • Apoptosis regulation: Mitigating cell death pathways.

  • Cell proliferation: Maintaining tissue homeostasis .

Tissue-Specific Functions

In mammals, Aph1A, Aph1B, and Aph1C isoforms exhibit divergent roles. While Aph1A knockout causes embryonic lethality and vascular defects, Aph1B and Aph1C deletions show milder phenotypes. This implies:

  • Complex heterogeneity: Distinct γ-secretase complexes may target specific substrates (e.g., Notch vs. APP) .

  • Therapeutic potential: Targeting specific Aph1 isoforms could reduce off-target effects in Alzheimer’s disease treatments .

Table 2: Key Research Applications

ApplicationDetails
Alzheimer’s disease modelsStudying amyloid-β production and Presenilin-dependent pathogenesis .
Notch signaling studiesInvestigating γ-secretase-mediated Notch cleavage and its role in development .
Structural biologyElucidating γ-secretase complex architecture using recombinant Aph-1 for co-expression with Presenilin and Pen2 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate your requirement when placing the order. We will prepare it according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require shipping with dry ice, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by numerous factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize the development of the specified tag.
Synonyms
aph-1; PSF; CG2855; Gamma-secretase subunit Aph-1; Presenilin-stabilization factor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-238
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
aph-1
Target Protein Sequence
MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSLWYALIPLKE FLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG MFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHI GYVVFSHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ
Uniprot No.

Target Background

Function
Aph-1 is an essential subunit of the gamma-secretase complex, an endoprotease complex responsible for catalyzing the intramembrane cleavage of integral membrane proteins such as Notch. It is believed to serve as a stabilizing cofactor for the presenilin homodimer, promoting the formation of a stable complex.
Gene References Into Functions
  1. APH-1 stabilizes the presenilin holoprotein within the complex, while PEN-2 is required for the endoproteolytic processing of presenilin, conferring gamma-secretase activity to the complex. PMID: 12660785
  2. Aph-1 and Nct may form a subcomplex that stabilizes the Psn holoprotein at an early stage in gamma-secretase assembly. PMID: 12771124
  3. The proper assembly of the Aph-1.nicastrin subcomplex with presenilin is essential for the trafficking and enzymatic activity of the gamma-secretase complex. Aph-1 functions as a stabilizing scaffold in the assembly of this complex. PMID: 15644323
  4. Aph-1 is required to promote cell survival in the wing imaginal disc. Cells lacking aph-1 are lost either through cell death or due to a defect in cell proliferation. PMID: 19191330
Database Links

KEGG: dme:Dmel_CG2855

STRING: 7227.FBpp0077400

UniGene: Dm.19771

Protein Families
APH-1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Drosophila melanogaster Aph-1 and how does it compare to mammalian homologs?

Drosophila melanogaster Aph-1 is a multipass transmembrane protein that functions as an essential component of the Presenilin (Psn)-mediated gamma-secretase complex. Unlike mammals which possess multiple APH-1 isoforms (APH-1aL, APH-1aS, APH-1b, and APH-1c), Drosophila has a single Aph-1 protein . The protein contains multiple transmembrane domains with functionally important polar residues, particularly conserved histidines in transmembrane domains 5 and 6 (corresponding to His-171 and His-197 in human APH-1aL) that play critical roles in gamma-secretase complex assembly and activity . When designing experiments with recombinant Drosophila Aph-1, researchers should account for these structural similarities and differences compared to mammalian systems, especially when translating findings across species.

What is the primary role of Aph-1 in gamma-secretase complex formation and function?

Aph-1 serves two crucial roles in gamma-secretase function. First, it stabilizes the newly synthesized Presenilin holoprotein to facilitate generation of the active form of Psn, which is a Psn-NTF/Psn-CTF heterodimer produced through Presenilinase-initiated endoproteolytic cleavage . Second, Aph-1 plays a role in regulating gamma-secretase activity independent of its function in promoting Psn endoproteolysis . The conserved histidine residues within Aph-1's transmembrane domains (particularly His-171 and His-197 in human APH1aL) are essential for stabilizing gamma-secretase complex assembly and affecting its proteolytic activity . For researchers working with recombinant Aph-1, it is critical to understand that mutations in these key residues can significantly alter both complex formation and enzymatic function.

How does loss of Aph-1 affect gamma-secretase complex assembly and cellular function in Drosophila models?

In Drosophila, loss of Aph-1 leads to failure of Presenilin heterodimer formation, resulting in compromised gamma-secretase activity . Additionally, Aph-1 has functions independent of its role in gamma-secretase regulation. For instance, Aph-1 is required to promote cell survival in the wing imaginal disc; aph-1 mutant cells are lost either through cell death or because of defects in cell proliferation . This function appears independent of gamma-secretase activity regulation but may involve downregulating uncleaved Psn holoprotein activity . Researchers should design experiments that can distinguish between gamma-secretase-dependent and independent effects when studying Aph-1 function, potentially using gamma-secretase inhibitors alongside Aph-1 mutations to delineate these distinct roles.

What are the optimal expression systems for producing functional recombinant Drosophila Aph-1?

When expressing recombinant Drosophila Aph-1, researchers should consider using systems that properly support transmembrane protein folding and complex assembly. For in vitro biochemical studies, insect cell expression systems (Sf9 or S2 cells) often provide the most appropriate environment for Drosophila proteins. For in vivo studies, the UAS/Gal4 inducible gene expression system in transgenic flies allows for spatiotemporal control of Aph-1 expression . When designing expression constructs, it's critical to avoid adding tags that might interfere with transmembrane domain interactions. As demonstrated in studies with human APH1aL, constructs should be designed without tags that might disrupt protein function . If tags are necessary, they should be positioned at the N- or C-terminus with flexible linkers, and validation experiments should confirm that the tagged protein retains normal interaction with other gamma-secretase components.

What purification strategies preserve the functional integrity of recombinant Aph-1?

Purification of recombinant Aph-1 requires careful consideration of its membrane-embedded nature. Based on protocols used for gamma-secretase components, membrane fractions should be isolated using differential centrifugation in buffers containing protease inhibitors (e.g., buffer A: 5 mM HEPES, pH 7.4, 1 mM EDTA, 0.25 M sucrose, and protease inhibitor mixture) . Solubilization of Aph-1 requires mild detergents that preserve protein-protein interactions, with 1% CHAPSO being commonly used for gamma-secretase components . For co-immunoprecipitation studies, approximately 300 μg of total solubilized membrane protein should be used with appropriate antibodies with overnight incubation at 4°C . Researchers should be aware that Aph-1 can form monomers and dimers, and both forms may be isolated during purification procedures, though only the monomeric form appears to interact with other gamma-secretase components .

How can researchers effectively evaluate Aph-1 incorporation into the gamma-secretase complex?

To assess Aph-1 incorporation into the gamma-secretase complex, co-immunoprecipitation experiments with antibodies against Aph-1 and other complex components (particularly Presenilin) are recommended. When analyzing these interactions, researchers should examine not only the presence of Presenilin N-terminal fragment (Psn-NTF) but also both mature and immature forms of nicastrin (NCT) . Wild-type Aph-1 incorporated into the gamma-secretase complex typically co-precipitates with Psn-NTF and both mature and immature NCT . Quantification of co-precipitated proteins through image analysis provides a reliable measure of interaction strength between Aph-1 and other complex components . Researchers should also be aware that APH-1 and immature NCT form a precomplex independent of other γ-secretase components, making the analysis of NCT maturation status particularly informative for assessing complex assembly stages .

Which key residues in Drosophila Aph-1 are critical for gamma-secretase complex function and how should mutation studies be designed?

Based on studies of human APH1aL, the conserved histidine residues in transmembrane domains 5 and 6 (corresponding to His-171 and His-197) are critical for gamma-secretase complex function . When designing mutation studies, researchers should consider:

  • Charge-altering mutations: Substituting histidines with alanine (H→A) to eliminate the imidazole side chain, or with lysine (H→K) to maintain positive charge .

  • Structure-disrupting mutations: Alterations that change the structural location of these histidines to assess positional importance .

  • Charge-reversal mutations: Substituting histidines with aspartic acid (H→D) to introduce negative charges .

These strategic mutations allow researchers to distinguish between the importance of the chemical properties of residues (charge, polarity) versus their structural positions. For quantitative assessment, researchers should analyze:

  • PS1 endoproteolysis levels

  • Nicastrin maturation

  • Co-immunoprecipitation efficiency with other complex components

  • Gamma-secretase enzymatic activity

How do mutations in Aph-1 differentially affect complex assembly versus proteolytic activity?

Mutations in key Aph-1 residues can distinctly affect complex assembly and proteolytic activity. For instance, in human APH1aL, His-171 and His-197 mutations show different effects:

MutationPS1 EndoproteolysisNCT MaturationComplex AssemblyProteolytic Activity
H171APartially reducedPartially reducedAltered binding patternSignificantly reduced
H171KImproved vs H171AImproved vs H171AStronger PS1 binding than H171AReduced despite assembly
H197ASeverely reducedSeverely reducedMinimal complex formationNegligible
H197KRestoredRestoredSimilar to wild-typeReduced despite assembly

This data demonstrates that charge-preserving mutations (H→K) can rescue complex assembly without restoring proteolytic activity, indicating that these residues contribute to both structural integrity and catalytic function . Researchers studying Drosophila Aph-1 should design experiments that separately assess complex formation (via co-immunoprecipitation and western blotting) and enzymatic activity (via substrate cleavage assays) to distinguish between these functions.

What are the differences between Aph-1 functions in early development versus adult neuronal maintenance in Drosophila models?

Aph-1 functions differ during development compared to adult neuronal maintenance. During embryonic development, Aph-1 is essential for proper morphogenesis, as evidenced by the severe developmental retardation observed in Aph-1-deficient embryos by embryonic day 9.5 . These developmental phenotypes resemble but are not identical to those of Notch1, nicastrin, or PS null embryos, suggesting both overlapping and distinct functions .

In adult neurons, Aph-1's role shifts more toward proteolytic processing of substrates involved in neurodegeneration. For studying Aph-1 function in adult Drosophila neurons, researchers should use conditional knockout or temperature-sensitive systems to bypass the developmental lethality. The UAS/Gal4 system with tissue-specific drivers provides an excellent approach for temporal and spatial control of Aph-1 expression . When designing such experiments, researchers should include appropriate controls such as rescue experiments with wild-type Aph-1 to confirm phenotype specificity.

How should researchers design Drosophila models to study Aph-1 in the context of Alzheimer's disease pathogenesis?

When designing Drosophila models to study Aph-1 in Alzheimer's disease pathogenesis, researchers should consider the following methodological approaches:

  • Direct Aβ expression models: To avoid complications from APP processing, researchers can use models where Aβ40/42 peptides are directly expressed by fusing them to a signal peptide (such as the Drosophila necrotic gene sequence) that ensures secretion . This allows direct assessment of Aβ toxicity without the confounding variables of APP processing.

  • Conditional Aph-1 manipulation: Using the UAS/Gal4 system for spatiotemporal control of Aph-1 expression allows researchers to modify Aph-1 levels or introduce mutant variants in specific tissues and developmental stages .

  • Combined genetic approaches: Researchers should design experiments that introduce Aph-1 modifications alongside Aβ expression to directly assess how Aph-1 variants influence Aβ-induced toxicity.

  • Relevant readouts: Appropriate phenotypic readouts should include lifespan measurements, locomotor assays, histological analysis of neurodegeneration, and biochemical assessment of Aβ levels and aggregation states.

What controls are necessary when assessing the effects of Aph-1 mutations on gamma-secretase substrates in Drosophila?

When assessing the effects of Aph-1 mutations on gamma-secretase substrates in Drosophila, several critical controls should be included:

  • Wild-type Aph-1 rescue: To confirm that observed phenotypes are specifically due to Aph-1 deficiency, experiments should include a rescue condition with wild-type Aph-1 expression .

  • Substrate processing controls: Researchers should monitor multiple gamma-secretase substrates (e.g., Notch, APP) to distinguish between substrate-specific effects versus general impairment of gamma-secretase activity .

  • Complex assembly verification: Co-immunoprecipitation experiments should confirm the incorporation of mutant Aph-1 proteins into the gamma-secretase complex by assessing interaction with PS1-NTF and mature/immature NCT .

  • Gamma-secretase-independent controls: To distinguish between gamma-secretase-dependent and independent functions of Aph-1, researchers should include conditions with gamma-secretase inhibitors in Aph-1 wild-type backgrounds .

  • Developmental timing controls: When studying adult phenotypes, researchers must use conditional systems to avoid confounding effects from developmental functions of Aph-1 .

How can researchers distinguish between direct effects of Aph-1 mutations versus secondary effects due to altered complex assembly?

Distinguishing between direct effects of Aph-1 mutations and secondary effects from altered complex assembly requires a multifaceted experimental approach:

  • Structure-function analysis: Compare mutations that affect complex assembly (e.g., human APH1aL H197A) versus those that allow complex formation but impair activity (e.g., H171K) . This separation allows researchers to isolate assembly-independent functions.

  • In vitro reconstitution: Using purified components to reconstitute gamma-secretase activity in vitro with various Aph-1 mutants can help determine direct contributions to enzymatic function.

  • Binding domain mapping: Systematic analysis of interaction domains between Aph-1 and other complex components through truncation and chimeric protein studies.

  • Temporal analysis: In inducible systems, monitoring the kinetics of complex assembly versus the onset of functional deficits can separate immediate versus consequential effects.

  • Substrate competition assays: Assessing whether specific Aph-1 mutations alter substrate preference can reveal direct roles in substrate recognition versus general complex stability.

What methods are most effective for quantifying changes in gamma-secretase activity resulting from Aph-1 mutations?

For quantifying changes in gamma-secretase activity resulting from Aph-1 mutations, researchers should employ multiple complementary approaches:

  • Western blot analysis of substrate processing: Monitoring the accumulation of substrate C-terminal fragments (CTFs) and reduction in intracellular domain (ICD) generation provides a semiquantitative measure of gamma-secretase impairment .

  • Enzyme activity assays: In vitro assays using fluorogenic peptide substrates allow direct measurement of catalytic efficiency (kcat/Km) for comparative analysis of different Aph-1 variants.

  • Mass spectrometry: Liquid chromatography-mass spectrometry (LC-MS) quantification of specific cleavage products (e.g., Aβ peptides) provides precise measurement of product formation .

  • Reporter gene assays: For Notch processing, luciferase-based transcriptional reporter assays can measure functional consequences of altered gamma-secretase activity.

  • In vivo phenotypic quantification: Systematic scoring of developmental phenotypes or neurodegeneration severity provides relevant biological readouts of gamma-secretase dysfunction .

How do interactions between Aph-1 and specific lipid environments affect gamma-secretase function?

While specific data on Aph-1-lipid interactions is limited in the provided search results, studies of gamma-secretase components suggest important methodological considerations:

  • Membrane composition effects: When performing in vitro studies, researchers should systematically vary membrane lipid composition (cholesterol content, sphingolipid levels, phospholipid species) to assess their influence on Aph-1 function and complex assembly.

  • Detergent selection: For solubilization and purification, researchers should compare multiple detergents beyond CHAPSO (1%) to identify conditions that best preserve native lipid interactions and functional activity .

  • Lipid raft association: Density gradient fractionation experiments should be performed to assess whether Aph-1 mutations alter localization to specific membrane microdomains, potentially explaining functional differences.

  • Lipid binding assays: Direct lipid binding studies (lipid overlay assays, surface plasmon resonance) with purified Aph-1 can identify specific lipid interactions that might be functionally relevant.

  • In vivo lipid modification: Genetic or pharmacological manipulation of lipid biosynthesis pathways in Drosophila can reveal the functional significance of specific lipid environments for Aph-1 activity.

How should researchers address inconsistent results between biochemical assays and in vivo phenotypes when studying Aph-1 mutations?

When faced with discrepancies between biochemical assays and in vivo phenotypes in Aph-1 studies, researchers should:

  • Evaluate gamma-secretase-independent functions: As demonstrated in Drosophila, Aph-1 has functions beyond gamma-secretase regulation, such as promoting cell survival in wing imaginal discs through mechanisms that may involve regulating uncleaved Psn holoprotein activity .

  • Consider developmental timing: Phenotypic consequences may vary depending on when Aph-1 function is disrupted during development versus adulthood .

  • Assess compensation mechanisms: Examine potential upregulation of alternative pathways that might compensate for chronic Aph-1 dysfunction in vivo but not in acute biochemical assays.

  • Evaluate substrate specificity: Different Aph-1 mutations may differentially affect processing of various gamma-secretase substrates, leading to substrate-specific phenotypes .

  • Quantify complex stoichiometry: Determine whether discrepancies arise from altered stoichiometry of gamma-secretase components in different experimental systems.

What are common technical pitfalls when working with recombinant Aph-1 and how can they be mitigated?

Common technical challenges when working with recombinant Aph-1 include:

  • Protein aggregation: Aph-1 can form dimers that do not incorporate into functional gamma-secretase complexes . Researchers should optimize solubilization conditions and perform size exclusion chromatography to isolate monomeric forms for functional studies.

  • Antibody specificity: Ensure antibodies can detect both monomeric and dimeric forms of Aph-1, as epitope accessibility may differ . Validation with Aph-1 knockout controls is essential.

  • Complex disassembly during purification: Harsh detergents can disrupt the gamma-secretase complex. Use mild detergents like CHAPSO (1%) and validate complex integrity through co-immunoprecipitation of all components .

  • Expression level artifacts: Overexpression may lead to non-physiological interactions or aggregation. Compare multiple expression levels and validate with endogenous protein studies.

  • Developmental lethality: Aph-1 deficiency causes embryonic lethality, requiring conditional systems for adult studies . Use tissue-specific or inducible expression systems to bypass developmental requirements.

How can researchers reconcile contradictory findings on Aph-1 function across different model systems?

When reconciling contradictory findings on Aph-1 function across model systems, researchers should:

  • Compare homolog differences: Mammals express multiple APH-1 isoforms (APH-1aL, APH-1aS, APH-1b, APH-1c) while Drosophila has a single Aph-1 protein . This difference may explain functional discrepancies, with mammalian isoforms potentially having specialized functions.

  • Assess developmental context: Aph-1-deficient phenotypes differ between embryonic and adult stages . Temporal analysis with stage-specific manipulations can resolve apparent contradictions.

  • Evaluate genetic background effects: Strain-specific modifiers may influence Aph-1 phenotypes. Use multiple genetic backgrounds and perform rescue experiments to confirm specificity.

  • Consider substrate repertoire differences: Different model organisms have distinct sets and expression patterns of gamma-secretase substrates. Directly compare processing of conserved substrates across systems.

  • Perform cross-species complementation: Test whether Aph-1 from one species can rescue defects in another to determine functional conservation. For example, test if human APH-1 isoforms can complement Drosophila Aph-1 deficiency .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.