Recombinant Drosophila melanogaster Gamma-secretase subunit pen-2 (pen-2)

Shipped with Ice Packs
In Stock

Description

Functional Role in γ-Secretase Activity

Pen-2 is indispensable for γ-secretase function, as demonstrated by:

  • Catalytic Activation: Required for presenilin endoproteolysis, which activates γ-secretase .

  • Substrate Processing:

    • Notch Receptors: Cleavage generates intracellular domains (ICDs) for signaling .

    • Amyloid Precursor Protein (APP): Lack of Pen-2 abolishes APP processing, unlike other subunit knockouts (e.g., NCT −/− retains ~5% activity) .

  • Neurodevelopmental Implications:

    • Postsynaptic Maturation: In Drosophila, Pen-2 mutants disrupt Frizzled 2 (Fz2) cleavage, impairing synaptic scaffolding and cytoskeletal organization .

    • Alzheimer’s Disease (AD) Link: Mutations in Pen-2 homologs alter Aβ42/Aβ40 ratios, mimicking AD-linked presenilin mutations .

Key Experimental Findings

  • Cysteine-Scanning Mutagenesis:

    • Hydrophobic Domain 1 (HD1) and Loop Domain: Located in a water-containing cavity near presenilin C-terminal fragments (CTFs) .

    • Proximity to Catalytic Site: Pen-2’s loop domain interacts with presenilin, suggesting a role in substrate positioning .

  • Genetic Knockout Studies:

    • Pen-2 −/− embryos exhibit Notch-deficiency phenotypes (e.g., vascular defects, delayed somitogenesis) .

    • Pen-2 mutants phenocopy presenilin mutations linked to familial AD, highlighting conserved γ-secretase roles .

Mechanistic Insights and Disease Relevance

  • Regulation of γ-Secretase Activity: Pen-2 modulates Aβ production ratios, with γ-secretase modulators binding preferentially to Pen-2 .

  • Synaptic Development: In Drosophila, γ-secretase-mediated Fz2 cleavage recruits postsynaptic proteins (e.g., α-spectrin), and pen-2 mutants exhibit "ghost boutons" .

  • Therapeutic Implications: Targeting Pen-2 interactions may offer avenues for modulating Aβ production in AD .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
pen-2; CG33198; Gamma-secretase subunit pen-2; Presenilin enhancer protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
pen-2
Target Protein Sequence
MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQSQIKRYVIYS AVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGSA
Uniprot No.

Target Background

Function
This protein is an essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch. It likely represents the final step in gamma-secretase maturation, facilitating endoproteolysis of presenilin and conferring gamma-secretase activity.
Database Links

KEGG: dme:Dmel_CG33198

STRING: 7227.FBpp0088783

UniGene: Dm.14392

Protein Families
PEN-2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What Experimental Methods Are Used to Express and Purify Recombinant Pen-2?

The most effective methodology for producing functional recombinant Drosophila Pen-2 follows this general protocol:

  • Expression System Selection: E. coli is the preferred expression system for full-length Drosophila Pen-2 due to its cost-effectiveness and high yield .

  • Vector Design: Typically using a vector containing:

    • N-terminal His-tag for purification

    • Strong promoter (often T7 for E. coli systems)

    • Appropriate antibiotic resistance marker

  • Purification Protocol:

    • Cell lysis under controlled conditions

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography for removing aggregates

    • Final purity assessment via SDS-PAGE (>90% purity standard)

  • Storage Considerations:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Recommended storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Reconstitution Procedure:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

How Do Pen-2 Knockout Phenotypes Inform Its Biological Function?

Studies of Pen-2 −/− embryos reveal profound developmental defects that illustrate the critical role of Pen-2 in Notch signaling pathways:

  • Vascular Defects:

    • Primitive immature blood vessel plexus

    • Blistered appearance compared with normal complex vasculature in wild-type littermates

  • Embryonic Abnormalities:

    • Smaller size compared to wild-type littermates

    • Abnormally large pericardial sac

    • Kinked neural tube

    • Truncated posterior region

    • Severely delayed somitogenesis

  • Developmental Features:

    • Visible optic and otic vesicles

    • Visible first branchial arch and forelimb buds

    • Delayed fusion of head folds

These phenotypic manifestations closely resemble Notch-deficiency phenotypes, confirming the essential role of Pen-2 in the γ-secretase complex that processes Notch. Importantly, Pen-2 −/− fibroblasts show complete absence of APP processing, contrasting with NCT −/− cells, which retain 5–6% of γ-secretase activity . This suggests Pen-2 may be even more critical for complex function than nicastrin.

How Do Specific Mutations in Different Domains of Pen-2 Impact γ-Secretase Function?

Systematic mutagenesis studies have revealed domain-specific effects of Pen-2 mutations on γ-secretase function, highlighting structure-function relationships:

Mutation RegionEffect on PS1 EndoproteolysisEffect on Proteolytic ActivityEffect on Complex Stability
First half of TMD1DecreasedDecreased (Aβ40 and Aβ42 reduced to 30-70% of WT)Moderate effect
Second half of TMD1Minimal effectIncreased (>2-fold increases in Aβ production)Minimal effect
N33A in TMD1Modest decreaseModest decrease~10-fold decrease
Cytosolic loop regionMinimal effectDecreasedModerate effect
I53A in loop regionMinimal effectReduced by half~10-fold decrease
TMD2DecreasedVariable effectsModerate effect
First half of TMD2Minimal effectDecreasedModerate effect
C-terminal residuesMinimal effectDecreasedSignificant effect
G22 and P27 in HD1Severely reducedSeverely reducedEssential for complex formation

Particularly significant findings include:

  • Mutations of bulky hydrophobic residues F25 and L26 in TMD1 most severely reduced Aβ production (30-50% of wild-type levels)

  • Mutations within the C-terminal conserved DYSLF motif affected both complex assembly and stabilization of PS fragments

  • Mutations in the second half of TMD1 (except W36) elevated Aβ production, with >2-fold increases in both Aβ40 and Aβ42

  • N-terminal lysine residues (K11 and K17) when mutated to alanine caused increases in Aβ40 and Aβ42 production

These findings demonstrate that different regions of Pen-2 contribute distinctly to complex stability, presenilin endoproteolysis, and proteolytic activity toward substrates.

What Methodologies Are Used to Assess Pen-2's Role in γ-Secretase Complex Stability and Trafficking?

Several specialized methodologies have been developed to investigate Pen-2's contributions to complex stability and trafficking:

  • Protein Stability Assays:

    • Proteasome Inhibition Protocol: Cells expressing Pen-2 mutants are treated with 10 μM MG132 (proteasome inhibitor) or DMSO control for 8 hours. Protein levels are then analyzed by SDS-PAGE and Western blotting. β-Catenin serves as a positive control to confirm proteasomal inhibition .

    • Cycloheximide Chase Assays: Cells are treated with cycloheximide to inhibit protein synthesis, and Pen-2 protein levels are monitored over time to determine degradation rates.

    • Pulse-Chase Experiments: Metabolic labeling with radioactive amino acids followed by immunoprecipitation to track protein turnover.

  • Complex Assembly Analysis:

    • Co-immunoprecipitation (Co-IP): Pulling down Pen-2 mutants and analyzing co-precipitated γ-secretase components.

    • Blue Native PAGE: Analyzing intact complexes under non-denaturing conditions to assess complex formation efficiency.

    • Sucrose Gradient Fractionation: Separating cellular components by size to determine incorporation of Pen-2 into high-molecular-weight complexes.

  • Trafficking Studies:

    • Cell Surface Biotinylation: Surface proteins are labeled with biotin, isolated with streptavidin, and analyzed by Western blotting to quantify cell surface expression .

    • Immunofluorescence Microscopy: Localizing Pen-2 mutants relative to organelle markers (ER, Golgi, endosomes).

    • Glycosylation Analysis: Examining Nct glycosylation patterns as an indicator of complex trafficking through the secretory pathway.

  • Functional Assessment:

    • Scanning Cysteine Accessibility Method (SCAM): Systematic replacement of residues with cysteine followed by labeling with membrane-impermeable sulfhydryl reagents to probe topology and accessibility .

    • Reporter Substrate Assays: Measuring cleavage of APP-based or Notch-based reporter substrates to assess γ-secretase activity.

These methodologies have revealed that mutations like N33A increase γ-secretase complexes at the cell surface despite modestly decreasing stability, while the I53A mutation reduces stability 10-fold and proteolytic activity by half .

What Is the Molecular Mechanism by Which Pen-2 Facilitates Presenilin Endoproteolysis?

The molecular mechanism of Pen-2-mediated presenilin endoproteolysis involves several coordinated steps:

  • Initial Complex Assembly:

    • Nicastrin (Nct) and Aph-1 form a heterodimeric intermediate complex

    • This complex binds to the C-terminal region of presenilin (PS), creating a stabilizing scaffold

    • Pen-2 is then recruited into this trimeric complex

  • Direct Interaction with Presenilin:

    • The N-terminal part of hydrophobic domain 1 (HD1) of Pen-2 interacts directly with transmembrane domain 4 (TMD4) of PS1

    • The proximal two-thirds of TMD4 of PS1, including the conserved Trp-Asn-Phe sequence, constitute the binding motif for Pen-2

    • This binding triggers conformational changes in PS1

  • Endoproteolysis Induction:

    • Upon Pen-2 binding, PS undergoes autocatalytic endoproteolysis between transmembrane domains 6 and 7

    • This creates N-terminal (PS NTF) and C-terminal (PS CTF) fragments that remain associated

    • Pen-2's interaction with both fragments, particularly through its C-terminal domain, stabilizes them against proteasomal degradation

  • Stabilization Function:

    • The conserved C-terminal domain of Pen-2, particularly the DYSLF motif, is crucial for stabilizing PS fragments after endoproteolysis

    • In the absence of this stabilizing function, both PS fragments and Pen-2 undergo rapid proteasomal degradation

    • When proteasomal degradation is blocked, complex formation between Pen-2 mutants and PS1 fragments can be recovered

This process is further influenced by glycine 22 and proline 27 in hydrophobic domain 1 of Pen-2, which are essential for complex formation and stability . The hydrophobic domain 1 and loop domain of Pen-2 are located in a water-containing cavity in close proximity to the PS1 CTF, positioning Pen-2 to influence the catalytic mechanism of the enzyme .

Recent in vitro studies have demonstrated that the combination of PS1 and Pen-2 alone is necessary and sufficient to induce PS endoproteolysis and γ-secretase-like activity, confirming Pen-2's direct role in PS activation .

How Does Pen-2 Research in Drosophila Provide Insights for γ-Secretase Function Across Species?

Drosophila melanogaster serves as an invaluable model system for γ-secretase research with broad cross-species applicability:

These cross-species insights have established that Pen-2 is more than just a structural component—it actively contributes to the catalytic mechanism of γ-secretase and represents a potential target for therapeutic intervention in diseases involving γ-secretase dysfunction, such as Alzheimer's disease.

What Advanced Imaging and Structural Biology Techniques Are Being Applied to Study Pen-2 Function?

Recent technological advances have transformed our ability to study Pen-2's structure and function with unprecedented precision:

  • Focused Ion Beam Scanning Electron Microscopy (FIB-SEM):

    • Enables isotropic imaging at 8 × 8 × 8 nm resolution

    • Allows visualization of membrane complexes including γ-secretase in situ

    • Techniques developed for Drosophila brain connectome studies (below) can be applied to visualize Pen-2 in native complexes

    FIB-SEM ParameterSpecificationApplication to Pen-2 Research
    Resolution8 × 8 × 8 nm voxelsVisualization of membrane protein complexes
    Field of viewUp to 300 μm wideWhole-cell context of γ-secretase localization
    Imaging timeYears of continuous imagingLong-term tracking of complex dynamics
  • Cryo-Electron Microscopy (Cryo-EM):

    • Near-atomic resolution of membrane protein complexes

    • Enables visualization of Pen-2's position and interactions within the γ-secretase complex

    • Can capture different conformational states of the complex during substrate processing

  • Scanning Cysteine Accessibility Method (SCAM):

    • Systematic replacement of residues with cysteine followed by labeling with membrane-impermeable sulfhydryl reagents

    • Applied to Pen-2 −/− fibroblasts reconstituted with mutant Pen-2

    • Demonstrated that hydrophobic domain 1 and the loop of Pen-2 are located in a water-containing cavity

    • Showed close proximity of these domains to PS1 CTF

  • In Vivo Calcium Imaging:

    • Spinning-disk confocal 3D imaging techniques developed for neuronal activity monitoring

    • Can be adapted to track γ-secretase complex dynamics in living cells

    • 3D tracking algorithms detect single cells from neuronal networks

  • Cross-Linking Mass Spectrometry (XL-MS):

    • Identifies protein-protein interaction sites at the amino acid level

    • Maps the precise contact points between Pen-2 and other γ-secretase components

    • Validates structural models derived from cryo-EM

These advanced techniques have revealed that the incorporation of a FLAG tag at the N-terminus of Pen-2 changes the conformation of PS1, resulting in an increased Aβ42/Aβ40 ratio similar to what is observed with familial Alzheimer's disease mutations in PS1 . This finding suggests that Pen-2 may play a direct role in determining the position of substrate cleavage sites.

How Can Researchers Design Comprehensive Mutagenesis Strategies to Explore Pen-2 Structure-Function Relationships?

Designing an effective mutagenesis strategy for Pen-2 requires systematic approaches to target key functional domains:

  • Domain-Specific Approaches:

    DomainKey ResiduesMutation ApproachExpected Impact
    TMD1 (N-terminal half)F25, L26, Y18, Y19Alanine substitutionReduced PS1 endoproteolysis and γ-secretase activity
    TMD1 (C-terminal half)N33, W36, F37Alanine substitutionAltered trafficking and variable effects on activity
    Cytosolic LoopI53Alanine substitutionReduced stability (10-fold) and activity (50%)
    TMD2VariousAlanine scanningDecreased PS1 endoproteolysis
    C-terminusDYSLF motifAlanine substitution of each residueImpaired PS fragment stabilization
  • Methodological Protocol:

    a. Vector Design:

    • Use QuikChange Lightning Site-Directed Mutagenesis kit with primers designed by PrimerX

    • Incorporate FLAG-tag for immunodetection

    • Include hygromycin resistance for stable cell line selection

    b. Expression System:

    • Transfect Pen-2 −/− fibroblasts for complementation assays

    • Create stable cell lines to ensure consistent expression levels

    • Use Drosophila S2 cells for species-specific studies

    c. Functional Assays:

    • Measure PS1 endoproteolysis via Western blotting

    • Quantify Aβ40 and Aβ42 production using ELISA

    • Assess protein stability with cycloheximide chase

    • Examine complex assembly via co-immunoprecipitation

  • Advanced Analysis Techniques:

    • Tandem mutations: Simultaneously mutate residues in different domains to identify synergistic effects

    • Cysteine cross-linking: Introduce cysteine pairs to test proximity of domains

    • Domain swapping: Exchange domains between Drosophila and human Pen-2 to test functional conservation

    • Rescue experiments: Test if human Pen-2 can rescue Drosophila Pen-2 knockout phenotypes

This comprehensive approach has revealed that glycine 22 and proline 27 in hydrophobic domain 1 of Pen-2 are essential for complex formation and stability , while simultaneous, but not individual, substitution of the highly conserved D90, F94, P97, and G99 residues with alanine interferes with Pen-2 function .

What Are the Experimental Considerations for Studying Pen-2's Role in Alzheimer's Disease Models?

Leveraging Drosophila Pen-2 studies for Alzheimer's disease research requires careful experimental design:

  • Model System Selection Criteria:

    Model SystemAdvantagesLimitationsApplication to Pen-2 Research
    Drosophila in vivoGenetic tractability, rapid lifecycle, conserved γ-secretase functionDifferences in APP processingStudy basic Pen-2 functions and genetic interactions
    Knockout mouse fibroblastsMammalian cellular contextLimited physiological relevanceBiochemical and trafficking studies
    Human neuronal cell linesHuman-specific protein interactionsOften immortalized cellsDirect disease relevance studies
    iPSC-derived neuronsPatient-specific genetic backgroundVariability between linesEffect of disease mutations on Pen-2 function
  • Critical Experimental Controls:

    • Rescue experiments: Confirm specificity of phenotypes by reintroducing wild-type Pen-2

    • Domain mutants: Use mutations in different domains as controls for specificity

    • Species comparisons: Test human Pen-2 in Drosophila systems to confirm conservation

    • Proteasome inhibition: Control experiments with MG132 to distinguish stability from function effects

  • Key Methodology Adaptations:

    a. APP Processing Analysis:

    • Use C99 substrate (human APP signal sequence followed by 99 C-terminal residues)

    • Implement sensitive ELISA protocols for Aβ40/Aβ42 quantification

    • Monitor AICD (APP intracellular domain) formation by Western blotting

    b. Relevance to Disease Mechanisms:

    • Focus on mutations that alter the Aβ42/Aβ40 ratio rather than total activity

    • Test interactions with familial Alzheimer's disease PS1 mutations

    • Assess impact of oxidative stress on Pen-2 function (relevant to disease states)

    c. Drug Screening Applications:

    • Establish high-throughput assays for compounds targeting Pen-2

    • Focus on molecules that modulate rather than inhibit γ-secretase activity

    • Test compounds identified in phenotypic screens for direct binding to Pen-2

  • Translational Considerations:

    • N-terminal modifications of Pen-2 change Aβ42/Aβ40 ratios similar to familial Alzheimer's disease mutations

    • γ-secretase modulators that decrease Aβ42 production bind primarily to Pen-2

    • Pen-2 stability may be a target for therapeutic intervention in Alzheimer's disease

The observation that Pen-2 can independently tune the amplitude of γ-secretase activity and modify the Aβ42/Aβ40 ratio makes it a particularly promising target for therapeutic interventions aimed at modulating rather than blocking γ-secretase function, potentially avoiding the side effects associated with complete inhibition of Notch processing.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.