Recombinant Drosophila melanogaster Glutamate-gated chloride channel (GluClalpha)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GluClalpha; GluCl; CG7535; Glutamate-gated chloride channel; DrosGluCl
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-456
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
GluClalpha
Target Protein Sequence
NNAKINFREKEKKVLDQILGAGKYDARIRPSGINGTDGPAIVRINLFVRSIMTISDIKME YSVQLTFREQWTDERLKFDDIQGRLKYLTLTEANRVWMPDLFFSNEKEGHFHNIIMPNVY IRIFPNGSVLYSIRISLTLACPMNLKLYPLDRQICSLRMASYGWTTNDLVFLWKEGDPVQ VVKNLHLPRFTLEKFLTDYCNSKTNTGEYSCLKVDLLFKREFSYYLIQIYIPCCMLVIVS WVSFWLDQGAVPARVSLGVTTLLTMATQTSGINASLPPVSYTKAIDVWTGVCLTFVFGAL LEFALVNYASRSGSNKANMHKESMKKKRRDLEQASLDAASDLLDTDSNATFAMKPLVRHP GDPLALEKRLQCEVHMQAPKRPNCCKTWLSKFPTRQCSRSKRIDVISRITFPLVFALFNL VYWSTYLFREEEDE
Uniprot No.

Target Background

Function
Recombinant *Drosophila melanogaster* Glutamate-gated chloride channel (GluClα) subunit. In conjunction with the GABA receptor Rdl, it plays a crucial role in visual response regulation by modulating the activity of ON/OFF-selective neurons.
Gene References Into Functions
  1. Glutamate hyperpolarizes all major cell types in the antennal lobe. This effect is inhibited by picrotoxin or by RNAi-mediated knockdown of the *GluClα* gene, which encodes a glutamate-gated chloride channel. PMID: 23729809
Database Links

KEGG: dme:Dmel_CG7535

STRING: 7227.FBpp0099473

UniGene: Dm.20644

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Glutamate-gated chloride channel (TC 1.A.9.4) subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the medulla layers (at protein level). Expressed in all major ON pathway medulla neurons (Mi1, Tm3, Mi4, and Mi9) and in OFF pathway neurons (Tm1, Tm2, Tm4, and Tm9).

Q&A

What is the Drosophila melanogaster GluClalpha and what is its biological significance?

The Drosophila melanogaster GluClalpha (DmGluClα) is a glutamate-gated chloride channel subunit that belongs to the family of ligand-gated ion channels. These channels are pivotal components of insect nervous systems, mediating inhibitory neurotransmission when activated by glutamate. Their biological significance extends to various physiological processes including locomotion, sensory processing, and nervous system development.

From a pharmacological perspective, GluClalpha represents a critical target for several insecticides and antiparasitic agents, including ivermectin and nodulisporic acid. These compounds act by directly activating the channel, leading to increased chloride ion influx and consequent inhibition of neuronal activity . The importance of GluClalpha is underscored by the fact that mutations in this channel can confer resistance to these compounds, as demonstrated in laboratory-selected resistant strains .

How does the structure of DmGluClalpha relate to its function?

DmGluClalpha features a typical ligand-gated ion channel architecture with several functional domains:

  • An extracellular N-terminal domain containing the glutamate binding site

  • Four transmembrane domains (M1-M4)

  • A large intracellular loop between M3 and M4

  • An extracellular C-terminus

The channel's functional properties are strongly influenced by specific structural elements. For instance, the P299 residue located immediately C-terminal to the M2 domain is highly conserved among glutamate-, GABA-, and glycine-gated chloride channels . This proline residue is critical for proper channel function, as evidenced by the P299S mutation identified in drug-resistant Drosophila strains that significantly alters sensitivity to multiple ligands, including the endogenous neurotransmitter glutamate .

The channel functions as a multimeric complex, and research indicates that native receptors might contain both glutamate-gated (DmGluClα) and GABA-gated (Rdl) chloride channel subunits, adding complexity to its pharmacological profile and physiological roles .

What expression systems are commonly used for recombinant DmGluClalpha studies?

The Xenopus laevis oocyte expression system represents the gold standard for functional studies of recombinant DmGluClalpha. This system offers several advantages for electrophysiological investigations:

  • Robust expression of functional channels following microinjection of in vitro synthesized RNA

  • Large cell size facilitating voltage-clamp recordings

  • Minimal endogenous channel expression that might interfere with measurements

  • Capability to express either homomeric channels or co-express with other subunits

The methodology typically involves:

  • Subcloning the DmGluClα cDNA into an appropriate vector (e.g., pBluescript)

  • In vitro transcription to generate capped mRNA (using systems like mMessage mMachine)

  • Microinjection of RNA into defolliculated Xenopus oocytes

  • Incubation period of 1-3 days to allow channel expression

  • Two-electrode voltage clamp recordings to assess channel function

Alternative expression systems include mammalian cell lines (HEK293, CHO cells) for biochemical studies and patch-clamp electrophysiology, though Xenopus oocytes remain predominant for pharmacological characterization.

How can researchers generate and characterize mutations in recombinant DmGluClalpha?

Generating targeted mutations in DmGluClalpha involves several methodological approaches:

Site-Directed Mutagenesis Protocol:

  • Subclone wild-type DmGluClα into an appropriate vector (e.g., pBluescript)

  • Generate single-stranded DNA template

  • Design custom mutagenic primers containing the desired mutation

  • Perform site-directed mutagenesis using commercial kits (e.g., Sculptor in vitro mutagenesis system)

  • Verify mutations by DNA sequencing

  • Add T7 promoter and poly(A+) tail by PCR for in vitro transcription

  • Transcribe RNA from wild-type and mutant templates

  • Express channels in Xenopus oocytes for functional characterization

Characterization Methodologies:

  • Electrophysiological comparison of wild-type and mutant channels:

    • Measure dose-response relationships for endogenous ligands and test compounds

    • Determine EC50 values by fitting data to the Hill equation

    • Compare activation/deactivation kinetics

    • Assess channel conductance and ion selectivity

  • Pharmacological profiling:

    • Test sensitivity to known agonists (glutamate) and modulators (ivermectin, nodulisporic acid)

    • Compare maximum current amplitudes relative to glutamate-activated currents

    • Evaluate potentiation effects at sub-activation concentrations

The P299S mutation investigation provides an excellent methodological template, demonstrating how a single point mutation can be characterized at both molecular and functional levels, revealing significant alterations in channel pharmacology.

What are the optimal electrophysiological protocols for studying DmGluClalpha channel kinetics?

Rigorous electrophysiological characterization of DmGluClalpha requires standardized protocols to ensure reproducible and comparable results:

Two-Electrode Voltage Clamp Protocol:

  • Recording setup: microelectrodes filled with 3M KCl (resistance 0.5-5 MΩ)

  • Holding potential: typically -60 to -80 mV

  • Perfusion system: capable of rapid solution exchange

  • Recording solutions: standard ND96 (96 mM NaCl, 2 mM KCl, 1 mM MgCl₂, 1.8 mM CaCl₂, 5 mM HEPES, pH 7.4)

Dose-Response Analysis:

  • Apply increasing concentrations of agonist (glutamate: typically 1 μM to 10 mM)

  • For irreversible compounds (nodulisporic acid, ivermectin), use separate oocytes for each concentration

  • Normalize responses to maximum glutamate-evoked currents

  • Plot normalized responses against log concentration

  • Fit data to Hill equation: I = Imax / [1 + (EC50/[A])^n] where [A] is agonist concentration

  • Compare EC50 values (e.g., wild-type DmGluClα: EC50(glutamate) = 19.5 μM; P299S mutant: EC50(glutamate) = 201 μM)

Important Considerations:

  • Allow sufficient washout periods between glutamate applications (1-2 minutes)

  • For irreversible compounds like nodulisporic acid (EC50 = 51 nM for wild-type), normalize to glutamate responses

  • Account for differences in activation kinetics (nodulisporic acid activates more slowly than glutamate)

  • Monitor current stability and oocyte health throughout recordings

This methodological approach facilitates precise quantification of channel properties and pharmacological responses, enabling direct comparison between wild-type and mutant channels.

How do alternative splicing and RNA editing affect DmGluClalpha function and recombinant expression?

DmGluClalpha undergoes complex post-transcriptional modifications that introduce functional diversity:

Alternative Splicing and RNA Editing Patterns:
Alternative splicing and RNA editing events have been documented in DmGluClalpha transcripts . These modifications can generate multiple channel variants with potentially distinct functional properties. Researchers should be aware that:

  • Multiple transcript variants may exist in vivo

  • The functional significance of each variant requires individual characterization

  • Specific variants may demonstrate differential sensitivity to agonists and modulators

  • Expression patterns of variants may vary by developmental stage or tissue

Methodological Approaches for Analysis:

  • RT-PCR analysis to identify transcript variants:

    • RNA extraction from whole flies or specific tissues

    • First-strand cDNA synthesis using oligo(dT) primers

    • PCR amplification with specific primers flanking variable regions

    • Cloning and sequencing of multiple independent clones to identify variants

  • Expression considerations for recombinant studies:

    • Clearly document which splice variant is being expressed

    • Consider expressing multiple variants to compare properties

    • When investigating mutations (e.g., P299S), introduce them into all relevant splice variants

    • Verify that recombinant transcripts match the intended sequence

In drug-resistant Drosophila strains like glc, sequencing revealed that the P299S mutation was present in all DmGluClalpha transcript variants examined, suggesting that this mutation affects all channel isoforms . This comprehensive analysis is crucial when exploring the molecular basis of phenotypes like insecticide resistance.

What methods can be used to investigate drug interactions with DmGluClalpha?

Investigating drug interactions with DmGluClalpha requires a multi-faceted experimental approach:

Binding Assays:

  • Preparation of membrane fractions:

    • Homogenize Drosophila heads (typically 100-200 per preparation)

    • Centrifuge homogenate to isolate membrane fractions

    • Resuspend in appropriate buffer for binding studies

  • Competition binding assays:

    • Use radiolabeled ligands or fluorescent probes

    • Determine binding parameters (Kd, Bmax) for reference compounds

    • Perform competition studies with test compounds

    • Calculate Ki values from IC50 using the Cheng-Prusoff equation

The glc fly strain demonstrated decreased binding affinity for both nodulisporic acid and ivermectin, correlating with the functional resistance observed in vivo .

Functional Characterization:

  • Direct activation assays:

    • Apply increasing concentrations of test compound to oocytes expressing DmGluClalpha

    • Measure current amplitude relative to glutamate-evoked currents

    • Determine EC50 values

    • Compare activation kinetics with reference compounds

  • Modulation studies:

    • Assess potentiation of glutamate responses at sub-activation concentrations

    • Examine competitive or non-competitive interactions

    • Investigate potential allosteric binding sites

Comparative Table: Pharmacological Properties of DmGluClalpha Ligands

CompoundWild-type EC50P299S Mutant EC50Activation CharacteristicsReversibility
Glutamate19.5 μM201 μMRapid activationReversible
Nodulisporic acid51 nM790 nMSlower activation than glutamateEssentially irreversible
Ivermectin25 nM340 nMSlow activationEssentially irreversible

This data demonstrates that the P299S mutation causes approximately 10-fold, 15-fold, and 14-fold reductions in sensitivity to glutamate, nodulisporic acid, and ivermectin, respectively .

How can researchers establish correlations between in vitro findings and in vivo phenotypes?

Establishing meaningful connections between recombinant channel studies and whole-organism effects requires integrative approaches:

Genetic Strategies:

  • Generation of resistant strains:

    • Select flies with stepwise increasing drug concentrations

    • Characterize resistance levels through dose-response mortality assays

    • Perform genetic mapping to identify resistance loci

    • Sequence candidate genes from resistant strains

  • Validation through reverse genetics:

    • Introduce identified mutations into wild-type flies using CRISPR/Cas9

    • Assess whether engineered mutations recapitulate resistance phenotypes

    • Compare physiological parameters between mutant and wild-type flies

Correlative Analysis:

  • Quantitative comparison of resistance levels:

    • In vitro: fold-change in EC50 values (e.g., 15-fold reduction in nodulisporic acid sensitivity)

    • In vivo: fold-change in lethal dose (e.g., 20-fold resistance to nodulisporic acid)

    • Analysis of discrepancies between in vitro and in vivo findings

  • Behavioral and physiological assessment:

    • Characteristic phenotypes of channel dysfunction (decreased locomotion, bang sensitivity)

    • Breeding performance (decreased brood size)

    • Developmental parameters

    • Electrophysiological recordings from neurons in situ

The glc fly strain exhibited multiple phenotypes beyond drug resistance, including decreased brood size, reduced locomotion, and bang sensitivity, suggesting broader neurophysiological consequences of the P299S mutation . Interestingly, the mutant flies appeared healthier when maintained on sublethal doses of nodulisporic acid, potentially because the drug partially restored glutamate-dependent neurotransmission impaired by the mutation .

What are the methodological considerations for studying heteromeric GluClalpha channels?

Native DmGluClalpha channels likely exist as heteromeric complexes rather than homomeric assemblies, necessitating specialized approaches:

Coexpression Studies:

  • RNA preparation for coexpression:

    • Generate separate RNA transcripts for each subunit

    • Mix RNAs at defined ratios before injection

    • Alternatively, inject different RNAs sequentially

  • Verification of heteromeric assembly:

    • Electrophysiological fingerprinting (unique properties of heteromers)

    • Biochemical approaches (co-immunoprecipitation, crosslinking)

    • Fluorescent protein tagging and FRET analysis

Heteromeric Combinations to Consider:

  • GluClalpha with other glutamate-gated channel subunits

  • GluClalpha with GABA-gated channel subunits (Rdl)

Evidence suggests that Drosophila nodulisporic acid receptors contain both glutamate-gated (DmGluClα) and GABA-gated (Rdl) chloride channel subunits, as indicated by immunoprecipitation studies . Supporting this hypothesis, flies carrying a mutation in the Rdl gene showed 5-fold resistance to nodulisporic acid .

Analytical Framework:

  • Compare properties of homomeric versus heteromeric channels:

    • Agonist sensitivity

    • Pharmacological profiles

    • Kinetic properties

    • Modulation by allosteric ligands

  • Investigate subunit-specific mutations:

    • Introduce mutations separately into individual subunits

    • Assess dominant-negative effects

    • Determine stoichiometry requirements for functional effects

This comprehensive approach can reveal complex pharmacological profiles that may not be evident from studies of homomeric channels alone, better reflecting the diversity of native receptor populations and their responses to both endogenous and exogenous ligands.

How should researchers address variability in recombinant DmGluClalpha expression studies?

Variability in expression systems can significantly impact experimental outcomes, requiring systematic approaches to ensure data reliability:

Sources of Variability:

  • Expression system factors:

    • Oocyte quality across different batches

    • RNA quality and concentration

    • Incubation time and temperature

    • Seasonal variations in Xenopus oocyte responsiveness

  • Channel-specific factors:

    • Alternative splicing variants

    • RNA editing events

    • Potential post-translational modifications

    • Assembly efficiency and trafficking

Methodological Solutions:

  • Standardization protocols:

    • Consistent RNA preparation methods

    • Quantification of RNA (concentration and integrity)

    • Fixed incubation periods (typically 1-3 days post-injection)

    • Paired experimental designs (test and control injections from same oocyte batch)

  • Normalization strategies:

    • Express drug-activated currents as percentage of glutamate-activated maximum current

    • Use internal controls within each experimental batch

    • Report both absolute and normalized values where appropriate

When studying nodulisporic acid activation of DmGluClα channels, researchers noted that "The relative current amplitudes varied somewhat between experiments, and values between 30% and 60% were observed, with average value of 43 ± 12% (n = 5)" . This approach of reporting both the range and mean with standard deviation provides appropriate transparency about experimental variability.

What statistical approaches are most appropriate for analyzing DmGluClalpha electrophysiological data?

Dose-Response Analysis:

  • Nonlinear regression fitting:

    • Hill equation fitting for concentration-response data

    • Comparison of EC50 values with appropriate confidence intervals

    • Statistical comparison of Hill coefficients

  • Comparison of fitted parameters:

    • Extra sum-of-squares F test for comparing entire curves

    • t-tests or ANOVA for comparing specific parameters (EC50, maximum response)

    • Bootstrap analysis for robust confidence intervals

Sample Size Considerations:

  • Power analysis to determine appropriate oocyte numbers

  • Technical replicates (multiple measurements from same oocyte)

  • Biological replicates (measurements across different oocyte batches)

Data Presentation Guidelines:

  • Include both representative traces and summarized data

  • Present concentration-response relationships on semi-logarithmic plots

  • Indicate number of replicates for each data point

  • Report both mean ± SEM and individual data points where feasible

In the nodulisporic acid resistance study, quantitative comparisons between wild-type and P299S mutant channels were performed by fitting concentration-response data to the Hill equation with a fixed Hill coefficient (nh = 2), enabling direct comparison of EC50 values across multiple ligands .

How can researchers differentiate between direct activation and allosteric modulation of DmGluClalpha?

Distinguishing between direct activation and allosteric modulation requires specialized experimental designs:

Experimental Framework:

  • Direct activation assessment:

    • Application of putative agonist alone

    • Concentration-dependent response profile

    • Comparison with known direct agonist (glutamate)

    • Analysis of activation kinetics and current characteristics

  • Allosteric modulation assessment:

    • Co-application of sub-threshold glutamate with test compound

    • Left-shift in glutamate dose-response curve

    • Changes in glutamate efficacy (maximum response)

    • Modulation of activation/deactivation kinetics

Case Study: Nodulisporic Acid
Nodulisporic acid has been demonstrated to directly activate DmGluClα channels in recombinant expression systems. Key experimental evidence included:

  • Concentration-dependent activation in the absence of glutamate

  • Maximum activation reaching 30-60% of glutamate-activated currents

  • Slower activation kinetics compared to glutamate

  • Essentially irreversible effects upon washout

Additionally, nodulisporic acid potentiated responses to glutamate at concentrations below those required for direct activation, indicating both direct agonist and allosteric modulator properties .

Distinguishing Features Table:

PropertyDirect ActivationAllosteric ModulationObserved with Nodulisporic Acid
Activation in absence of glutamateYesNoYes
Potentiation of glutamate responseNot necessarilyYesYes
Effect on glutamate EC50Not applicableDecreasedYes
ReversibilityCompound-dependentCompound-dependentEssentially irreversible

This comprehensive analysis framework enables precise classification of compound effects and reveals the complex pharmacology of ligands like nodulisporic acid that may possess multiple mechanisms of action at the same receptor.

How can recombinant DmGluClalpha be used to screen for novel insecticides?

Recombinant DmGluClalpha represents a valuable platform for insecticide discovery and characterization:

Screening Methodologies:

  • High-throughput electrophysiology:

    • Automated patch-clamp systems

    • Fluorescent voltage/ion indicators in cell lines

    • Membrane potential dyes with plate reader detection

  • Binding assays:

    • Displacement of radiolabeled or fluorescent ligands

    • Surface plasmon resonance for direct binding analysis

    • Thermostability assays to detect ligand-induced conformational changes

  • Functional characterization workflow:

    • Initial screening for channel activation or modulation

    • Concentration-response determination for active compounds

    • Selectivity profiling against mammalian channels

    • Structure-activity relationship analyses

Validation Framework:

  • Comparative potency assessment:

    • Testing against multiple insect GluCl channels

    • Species selectivity profiling

    • Comparison with established compounds (e.g., ivermectin)

  • Resistance profiling:

    • Testing against known resistance mutations (e.g., P299S)

    • Engineering additional mutations to predict resistance mechanisms

    • Assessment of cross-resistance patterns

The nodulisporic acid study exemplifies this approach, demonstrating how electrophysiological characterization of recombinant channels provided direct evidence for the compound's mode of action and revealed the molecular basis of resistance .

What insights can DmGluClalpha structure-function studies provide for insecticide design?

Structure-function analysis of DmGluClalpha offers strategic opportunities for rational insecticide design:

Critical Structural Determinants:

  • Binding site mapping:

    • Mutagenesis of potential binding pocket residues

    • Chimeric constructs between sensitive and resistant channels

    • Molecular modeling and docking studies

  • Key functional domains:

    • The P299 residue (mutated in resistant flies) is located C-terminal to the M2 domain

    • This region is critical for channel gating and modulator sensitivity

    • Targeting alternative binding sites could potentially overcome resistance

Resistance Management Strategies:

  • Proactive design approaches:

    • Develop compounds targeting multiple binding sites

    • Focus on residues with high functional constraints (less tolerance for mutation)

    • Create compound libraries with diverse chemical scaffolds

  • Cross-resistance analysis:

    • The P299S mutation affects sensitivity to multiple structurally distinct ligands

    • This suggests a common functional mechanism rather than direct binding interference

    • Compounds binding to alternative sites may retain efficacy against P299S mutants

The finding that a single mutation (P299S) confers reduced sensitivity to glutamate, nodulisporic acid, and ivermectin indicates that this region plays a crucial role in channel activation by diverse ligands . This insight suggests that designing compounds that act through alternative mechanisms or binding sites could potentially overcome this resistance mechanism.

How can researchers investigate species selectivity of compounds targeting GluClalpha channels?

Species selectivity is critical for developing insecticides with favorable safety profiles:

Comparative Expression Studies:

  • Parallel characterization workflow:

    • Clone GluClalpha orthologs from target and non-target species

    • Express in standardized recombinant systems (e.g., Xenopus oocytes)

    • Perform side-by-side pharmacological characterization

    • Calculate selectivity indices (ratio of EC50 values)

  • Chimeric and mutant channel analysis:

    • Generate chimeras between insect and vertebrate channels

    • Identify regions conferring selective responses

    • Introduce specific point mutations to map determinants of selectivity

Molecular Basis of Selectivity:

  • Sequence divergence analysis:

    • Alignment of GluClalpha sequences across species

    • Identification of non-conserved residues in binding sites

    • Correlation with pharmacological differences

  • Structural insights:

    • Homology modeling based on available structures

    • Binding site comparison across species

    • Structure-based design of selective compounds

Ivermectin's selective toxicity to invertebrates versus vertebrates exemplifies the importance of understanding species-specific differences in glutamate-gated chloride channels. Similar approaches can be applied to novel compounds like nodulisporic acid to ensure selective targeting of insect channels while minimizing effects on non-target organisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.