Recombinant Drosophila melanogaster GPI mannosyltransferase 4 (CG3419)

Shipped with Ice Packs
In Stock

Description

Introduction to GPI Anchors and Mannosyltransferases

Glycosylphosphatidylinositol (GPI) anchors are complex glycolipid structures that play a crucial role in attaching various proteins to cell membranes. These anchors are essential for the proper functioning of numerous signaling and cell adhesion proteins across eukaryotic organisms . The biosynthesis of GPI anchors involves a multi-step process requiring several specialized enzymes, including a series of glycosylphosphatidylinositol-mannosyltransferases (GPI-MTs) .

In the GPI biosynthesis pathway, mannosyltransferases are responsible for adding mannose residues to the developing anchor structure. The basic GPI anchor contains three core mannose units, while some organisms, including yeast, certain protozoa, and mammals, incorporate a fourth mannose residue . Each mannose addition is catalyzed by a specific enzyme: PIG-M (with auxiliary protein PIG-X) attaches the first mannose via an α1-4 bond to the glucosamine unit; PIG-V adds the second mannose via an α1-6 bond; PIG-B incorporates the third mannose via an α1-2 bond; and PIG-Z (GPI mannosyltransferase 4) adds the fourth mannose, also via an α1-2 bond .

Drosophila melanogaster, commonly known as the fruit fly, serves as an important model organism for studying these fundamental biological processes. The CG3419 gene in Drosophila encodes GPI mannosyltransferase 4, which is homologous to mammalian PIG-Z. This conservation across species highlights the fundamental importance of the GPI anchor biosynthesis pathway in cellular function and development.

Functional Role in GPI Anchor Biosynthesis

GPI mannosyltransferase 4 (CG3419/PIG-Z) occupies a specific position in the GPI anchor biosynthesis pathway, catalyzing the addition of the fourth mannose residue to the anchor structure. This enzymatic action represents one of the later steps in the biosynthetic pathway and contributes to the final structure of the mature GPI anchor .

The importance of proper GPI anchor biosynthesis is underscored by studies on related GPI-mannosyltransferases. For instance, research on Drosophila GPI-MT2 has demonstrated that mutations in this gene lead to defects in the GPI-mediated membrane attachment of several GPI-anchored proteins, including the photoreceptor-specific cell adhesion molecule chaoptin . These defects result in impaired protein trafficking to the plasma membrane in photoreceptor cells, leading to microvillar instability, photoreceptor cell pathology, and ultimately retinal degeneration .

While the specific consequences of GPI mannosyltransferase 4 dysfunction in Drosophila have not been as extensively characterized, its evolutionary conservation suggests a fundamental importance. The enzyme likely plays a crucial role in ensuring the proper attachment and function of specific GPI-anchored proteins involved in various cellular processes, including signaling, adhesion, and development.

The GPI anchoring system represents a sophisticated mechanism for attaching proteins to membranes, distinct from transmembrane protein insertion. This system allows for specialized membrane localization and potentially regulated release through phospholipase action. Understanding the enzymes involved in this process, including GPI mannosyltransferase 4, provides insights into fundamental cellular mechanisms relevant to both normal physiology and disease states.

Research Applications and Significance

The recombinant Drosophila melanogaster GPI mannosyltransferase 4 (CG3419) protein serves as a valuable tool for multiple research applications in biochemistry, cell biology, and developmental biology. Key applications include:

Structural and functional studies of GPI mannosyltransferases represent a primary application. By providing purified enzyme, researchers can investigate the catalytic mechanism, substrate specificity, and structure-function relationships of this important class of enzymes. Such studies can contribute to our understanding of the fundamental biochemistry underlying GPI anchor biosynthesis.

The protein can also be used for generating specific antibodies, which in turn enable immunodetection of the native enzyme in Drosophila tissues. These antibodies facilitate studies on the expression patterns, subcellular localization, and developmental regulation of GPI mannosyltransferase 4. Immunological reagents derived from the recombinant protein can help elucidate the spatial and temporal dynamics of GPI anchor biosynthesis in vivo.

Additionally, the recombinant protein provides a foundation for comparative studies across species. By examining the properties of Drosophila GPI mannosyltransferase 4 alongside its homologs from other organisms, researchers can gain insights into the evolution and conservation of the GPI anchor biosynthesis pathway. Such comparative approaches can highlight both universal features and species-specific adaptations in this fundamental cellular process.

Understanding GPI anchor biosynthesis has broader implications for human health and disease. Defects in human GPI biosynthesis genes cause congenital disorders of glycosylation, which present with developmental delay, seizures, and other neurological abnormalities. Studies in model organisms like Drosophila can provide valuable insights into the mechanisms underlying these disorders and potentially suggest therapeutic approaches.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
PIG-Z; CG45068; GPI mannosyltransferase 4; GPI mannosyltransferase IV; GPI-MT-IV; Phosphatidylinositol glycan anchor biosynthesis protein class Z
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-696
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
PIG-Z
Target Protein Sequence
MRLTTLWQNRSPGDRHLSTYFCFAAVRLLLVFVPQLGYVHPDEFFQSVEVMTGDHFRLEH TRTWEFNNSLPVRSIVLPFALLRIPWSFYEFVAECLKAWWQLELLGTYAYVVFPRLIYTL ISFSNDYCLFRICRLYGLRFEIRLLAMGSSWILLVFGTRTFSNSLEMAMCSWLLCLVSEC MLRTNTVVYKKEFLEEKYDKAESISERVRIWKLKNSLPAHNLQHLMAMSTICVAGVFNRP TFLLFGAPMVFFWLLRGMGTRSITFRDFNLRIALFCLCALPALVLFIFCDSLYYQHLTLG ELHMMHLSIDNFVFTPWNFIKANLDSAQTASHGVHPCYVHLMVNMPMLFNVLALASLGAF AQLLLRFFRAEYQVLPRFQSIVSLMSGAIFVPLFFLSLINHQEPRFLLPVTFPLILLHAP KLITGFSAKYPFQKDHPLLRLFYDKLLSSKASGPYLLKIWYVSNVALTLFFGFIHQAGVY PLAADISHVIATKPAATHVHLITSHIYSLPLHLINIPSSRVLHFNRLTHQRYRRPRDFYM YEYGGLPLDSLLQKVKLISGSCEVKKSGPSRRRYKLYLAIPASLSADLHEALVHSNASSY LNFELLKVFYPHLSTEAFPHLQGRHPCDVDAPHWAHDDLRGTCSAEQLPAFSFAYLNKQF SSFVHQLGLALYEIDVTRNKPRSVVIKKASMTETAA
Uniprot No.

Target Background

Function
Mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers a fourth mannose to certain trimannosyl-GPIs during GPI precursor assembly.
Database Links

KEGG: dme:Dmel_CG45068

STRING: 7227.FBpp0072198

UniGene: Dm.13579

Protein Families
Glycosyltransferase 22 family, PIGZ subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the functional role of GPI mannosyltransferase 4 (CG3419) in Drosophila melanogaster?

GPI mannosyltransferase 4 (CG3419) is a critical enzyme in the glycosylphosphatidylinositol (GPI) anchor biosynthesis pathway in Drosophila melanogaster. This enzyme specifically catalyzes the transfer of mannose from dolichol-phosphate-mannose to the GPI anchor precursor. The full-length protein (696 amino acids) contains multiple transmembrane domains and catalytic regions essential for its function. GPI anchors are glycolipid structures that anchor proteins to the outer leaflet of the plasma membrane, playing crucial roles in cell signaling, membrane trafficking, and developmental processes in Drosophila.

How can researchers verify the purity and integrity of recombinant GPI mannosyltransferase 4 (CG3419)?

Verification of recombinant GPI mannosyltransferase 4 (CG3419) purity should involve multiple analytical approaches. First, perform SDS-PAGE analysis, where the recombinant protein should appear as a single band with >90% purity as indicated by commercial preparations . For higher resolution assessment, size exclusion chromatography can identify potential aggregates or degradation products. Western blotting using anti-His antibodies can confirm the presence of the His-tag fusion protein. Mass spectrometry analysis provides definitive confirmation of protein identity and integrity by matching peptide fragments to the expected sequence. Circular dichroism spectroscopy helps evaluate secondary structure integrity, which is particularly important for ensuring proper folding of membrane-associated proteins like GPI mannosyltransferase 4.

What expression systems are most suitable for producing functional GPI mannosyltransferase 4 (CG3419)?

While E. coli is commonly used for expressing recombinant GPI mannosyltransferase 4 (CG3419) , researchers should consider alternative expression systems for functional studies. E. coli expression offers high yields but may lack proper post-translational modifications needed for full activity. Baculovirus-infected insect cell systems provide a more native environment for Drosophila proteins and better post-translational modifications. For highest fidelity, Drosophila S2 cell expression systems offer the most authentic cellular context. When using E. coli, specialized strains like Rosetta or Origami may improve folding of this complex protein. Co-expression with chaperones may enhance proper folding, particularly for transmembrane domains present in GPI mannosyltransferase 4.

What are the optimal conditions for reconstitution and storage of recombinant GPI mannosyltransferase 4 (CG3419)?

For optimal reconstitution of lyophilized recombinant GPI mannosyltransferase 4 (CG3419), first centrifuge the vial briefly to ensure all material is at the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage stability, add glycerol to a final concentration of 5-50% (with 50% being standard practice) . Aliquot the reconstituted protein into single-use volumes to avoid repeated freeze-thaw cycles, as these significantly reduce activity. Store aliquots at -80°C for long-term storage or at 4°C for up to one week if in active use . For membrane-associated proteins like GPI mannosyltransferase 4, consider adding non-ionic detergents (0.1% Triton X-100 or 0.05% DDM) to maintain solubility and prevent aggregation during storage.

How should researchers design activity assays for GPI mannosyltransferase 4 (CG3419)?

Designing robust activity assays for GPI mannosyltransferase 4 requires careful consideration of enzyme kinetics and substrate availability. The assay should measure the transfer of mannose from dolichol-phosphate-mannose to GPI anchor precursors. A typical assay contains purified recombinant enzyme (10-100 ng), synthetic or extracted GPI precursors, radiolabeled or fluorescently-labeled dolichol-phosphate-mannose, and appropriate buffers (typically 50 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgCl₂, and 5 mM MnCl₂). Reaction products can be separated by thin-layer chromatography or HPLC and quantified by scintillation counting or fluorescence detection. Always include positive controls (commercially available mannosyltransferases) and negative controls (heat-inactivated enzyme) to validate assay performance. The assay should include time-course measurements to ensure linearity and substrate concentration series to determine Km and Vmax values.

What purification strategies are most effective for His-tagged GPI mannosyltransferase 4 (CG3419)?

Purification of His-tagged GPI mannosyltransferase 4 requires a multi-step approach to achieve high purity while maintaining activity. Begin with immobilized metal affinity chromatography (IMAC) using Ni-NTA resin, with binding in buffer containing 20-50 mM imidazole to reduce non-specific binding, followed by elution with 250-300 mM imidazole. Given the hydrophobic nature of this membrane-associated enzyme, include 0.1% non-ionic detergent (such as DDM or Triton X-100) in all buffers to maintain solubility. Follow IMAC with size exclusion chromatography to remove aggregates and achieve >90% purity . For challenging preparations, consider ion exchange chromatography as an intermediate step. Validate purification success at each step using SDS-PAGE and western blotting with anti-His antibodies. Monitor protein activity throughout purification to ensure the protocol preserves enzymatic function.

How can recombinant GPI mannosyltransferase 4 (CG3419) be used to study developmental processes in Drosophila?

Recombinant GPI mannosyltransferase 4 can serve as a powerful tool for investigating developmental processes in Drosophila through multiple experimental approaches. Given the evolutionary conservation of GPI biosynthesis pathways across species and their importance in development , researchers can develop in vitro assays using the recombinant protein to screen for specific inhibitors or activators. These modulators can then be applied in vivo to study temporal effects of GPI anchor disruption at specific developmental stages. Another approach involves generating antibodies against the recombinant protein for immunohistochemical studies to map expression patterns throughout development. Complementary to this, researchers can conduct structure-function analyses by creating point mutations in the recombinant protein based on the published amino acid sequence (696 amino acids) , followed by transgenic expression of these variants to elucidate the importance of specific domains during developmental processes.

What approaches should be used for investigating protein-protein interactions involving GPI mannosyltransferase 4 (CG3419)?

Investigating protein-protein interactions of GPI mannosyltransferase 4 requires multiple complementary approaches due to its membrane-associated nature. Proximity-based labeling techniques like BioID or APEX2 are particularly suitable, as these methods can capture transient interactions in the native cellular environment. The recombinant His-tagged protein can be used in pull-down assays coupled with mass spectrometry to identify binding partners, though careful optimization of detergent conditions is necessary to maintain protein-protein interactions while solubilizing membrane components. For validation of specific interactions, microscale thermophoresis offers advantages for membrane proteins as it requires minimal sample amounts and can be performed in detergent-containing buffers. Split-reporter assays such as bimolecular fluorescence complementation provide spatial information about interactions in Drosophila cells. These approaches should be integrated with computational predictions based on the full amino acid sequence to build a comprehensive protein interaction network.

How do replication timing and genomic location affect expression studies of GPI mannosyltransferase 4 (CG3419)?

The genomic context of GPI mannosyltransferase 4 should be considered when designing expression studies. Research in Drosophila has demonstrated that late-replicating regions of the genome are associated with different mutation and duplication rates , which may affect experimental design when studying CG3419. If CG3419 is located in late-replicating regions, researchers should anticipate potential challenges in expression timing during the cell cycle. When designing CRISPR-Cas9 genome editing experiments targeting CG3419, the replication timing of the locus should inform the optimal time for introducing edits. Similarly, when analyzing natural variants of CG3419 across Drosophila populations, researchers should account for potential duplication hotspots, as these regions show distinct evolutionary patterns . Transcriptional studies should include time-course analyses throughout the cell cycle to capture potential replication timing-dependent expression variations.

What are common challenges in expressing recombinant GPI mannosyltransferase 4 (CG3419) and how can they be addressed?

Recombinant expression of GPI mannosyltransferase 4 presents several challenges due to its complex membrane-associated nature. Low expression yields in E. coli systems can be addressed by optimizing codon usage for bacterial expression or switching to eukaryotic systems like insect cells. Protein aggregation during expression, often indicated by inclusion body formation, may be mitigated by lowering induction temperature (16-20°C), reducing inducer concentration, or adding solubilizing agents to the culture medium. Improper folding is a significant concern for this 696-amino acid transmembrane protein ; consider co-expression with molecular chaperones or fusion to solubility-enhancing partners like thioredoxin or SUMO. Loss of activity during purification frequently results from detergent-mediated disruption of protein structure; systematic screening of different detergent types and concentrations is essential for maintaining function. Degradation during expression can be countered by adding protease inhibitors throughout the purification process and using protease-deficient expression strains.

How can researchers interpret conflicting activity data for GPI mannosyltransferase 4 (CG3419)?

When facing conflicting activity data for GPI mannosyltransferase 4, a systematic analytical approach is necessary. First, assess assay conditions across experiments—particularly pH, temperature, and buffer composition—as membrane proteins are notably sensitive to these parameters. The presence of different detergents can dramatically alter enzyme kinetics; standardize detergent type and concentration. Evaluate protein quality metrics (purity, aggregation state, thermal stability) before each activity measurement, as these factors directly impact functional readouts. Consider the substrate source and quality, as synthetic GPI precursors may behave differently than native substrates. For kinetic discrepancies, construct complete Michaelis-Menten curves rather than single-point measurements to identify whether Vmax or Km parameters are affected. Finally, variation between protein batches is common for complex transmembrane proteins like GPI mannosyltransferase 4; implement rigorous quality control testing of each preparation against a well-characterized reference standard.

ParameterOptimal RangeCommon PitfallSolution
pH7.0-7.5Using standard buffers without optimizationTest activity in 0.2 pH unit increments
Temperature22-28°CAssuming room temperature is optimalConduct temperature gradient experiments
Detergent0.01-0.1%Excess detergent causing denaturationTitrate detergent below CMC
Substrate concentration10-100 μMWorking below KmDetermine Km experimentally
Divalent cationsMn²⁺, Mg²⁺ (1-5 mM)Omitting essential cofactorsTest multiple cofactors and combinations

What controls are essential when studying evolutionary conservation of GPI mannosyltransferase 4 (CG3419) across species?

When investigating evolutionary conservation of GPI mannosyltransferase 4 across species, multiple control measures are critical for valid comparisons. First, establish positive controls using well-characterized mannosyltransferases with known conservation patterns, such as PhLP3, which shows high conservation across species and plays essential roles in development . Include negative controls using proteins with species-specific functions lacking broad conservation. Create alignment-based controls by identifying highly conserved domains versus variable regions within the 696-amino acid sequence to establish baseline expectations for conservation signals. When performing functional complementation assays, use domain-swapping experiments between orthologs to identify functionally conserved regions. For expression pattern comparisons, normalize transcript levels against multiple reference genes selected for consistent expression across target species. When comparing enzymatic activities between species, standardize assay conditions for each ortholog individually before comparative analysis, as optimal conditions may vary. Finally, integrate phylogenetic controls by including appropriate outgroups and testing for lineage-specific selection pressures on GPI mannosyltransferase 4.

How might CRISPR-Cas9 technology be optimally applied to study GPI mannosyltransferase 4 (CG3419) function in Drosophila?

CRISPR-Cas9 approaches offer powerful tools for investigating GPI mannosyltransferase 4 function in vivo. Design gene knockout strategies using multiple guide RNAs targeting different exons to ensure complete ablation of function, particularly focusing on the catalytic domains identified from the amino acid sequence . For more nuanced analysis, implement precise editing to create point mutations in specific functional domains based on structural predictions from the protein sequence. Consider generating conditional knockouts using tissue-specific or temporally regulated Cas9 expression to bypass potential embryonic lethality. For monitoring protein dynamics, create fluorescent protein knock-in lines at the endogenous locus to visualize the native expression patterns and subcellular localization. Implement base editing approaches for studying the effects of naturally occurring variants. When designing experiments, consider potential genomic context effects, as research has shown that late-replicating regions in Drosophila may influence mutation rates and duplication events . For phenotypic analysis, focus on developmental processes that rely on GPI-anchored proteins, particularly examining structural integrity of tissues that depend on cell surface protein interactions.

What are the emerging technologies for studying the structural biology of membrane proteins like GPI mannosyltransferase 4 (CG3419)?

Recent technological advances have transformed structural studies of challenging membrane proteins like GPI mannosyltransferase 4. Cryo-electron microscopy (cryo-EM) now enables high-resolution structural determination without the need for protein crystallization, particularly beneficial for this 696-amino acid transmembrane protein . Researchers should consider using amphipols or nanodiscs as alternatives to detergents for stabilizing the native conformation during cryo-EM sample preparation. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) provides valuable insights into protein dynamics and conformational changes upon substrate binding without requiring full structural determination. For computational approaches, AlphaFold2 and RoseTTAFold can generate high-confidence structural models based on the amino acid sequence , particularly useful for designing targeted mutations. Single-molecule Förster resonance energy transfer (smFRET) allows visualization of conformational dynamics during catalysis. Micro-electron diffraction (microED) enables structural determination from nanocrystals that would be insufficient for traditional X-ray crystallography. Integration of these approaches can provide complementary insights into the structure-function relationship of GPI mannosyltransferase 4.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.