Recombinant Drosophila melanogaster Gustatory and odorant receptor 21a (Gr21a)

Shipped with Ice Packs
In Stock

Description

Functional Role in CO₂ Detection

Gr21a functions as a heteromeric receptor alongside Gr63a to detect CO₂, a key ecological signal for Drosophila.

Key Mechanisms:

  • Heterodimer Formation: Gr21a and Gr63a form a heteromeric complex essential for CO₂ sensitivity. Co-expression in Xenopus laevis oocytes generates dose-dependent inward currents upon sodium bicarbonate application, confirming receptor activation .

  • Ligand Specificity:

    • Activators: Sodium bicarbonate (EC₅₀ = 142 ± 23 mM) , carbonated solutions, methyl pyruvate, and n-hexylamine .

    • Inhibitors: 1-Hexanol, citronellol, and 2,3-butanedione block receptor activity .

Table 1: Functional Responses of Recombinant Gr21a in Xenopus Oocytes

Receptor ConfigurationCurrent Amplitude (μA)Key Ligands
Gr21a/Gr63a (heteromeric)2.9 ± 1.0Sodium bicarbonate, CO₂
Gr21a (homomeric)1.9 ± 0.6Sodium bicarbonate
Gr63a (homomeric)2.5 ± 1.2Sodium bicarbonate
Data sourced from PLOS ONE (2023) .

Behavioral and Ecological Implications

  • Avoidance Behavior: Activation of Gr21a/Gr63a neurons triggers aversion to CO₂, critical for evading harmful environments .

  • Context-Dependent Valence: Inhibitors like amines attract flies in low-CO₂ environments, while activators induce aversion .

  • Evolutionary Conservation: Orthologs of Gr21a and Gr63a exist in disease vectors like Anopheles and Aedes mosquitoes, highlighting their ecological significance .

Table 2: Recombinant Gr21a Production Systems

Host SystemPurityApplications
Cell-Free Expression≥85%Structural studies
E. coli/Yeast≥85%Ligand screening assays
Mammalian Cells≥85%Functional characterization
Data from MyBioSource .
  • Functional Assays: The "empty neuron" system (lacking endogenous receptors) demonstrates that Gr21a/Gr63a co-expression restores CO₂ responsiveness in Drosophila olfactory neurons .

  • Pharmacological Screening: Identified blockers (e.g., citronellol) have potential applications in insect repellent development .

Key Research Findings

  1. Dosage-Dependent Activation: Increasing Gr21a or Gr63a gene dosage enhances CO₂ response magnitude and spontaneous neuronal activity .

  2. Signal Modulation: Gr21a/Gr63a interacts with TRPC channels via Gα49B and Plc21C, linking receptor activation to calcium signaling .

  3. Species-Specific Adaptations: While absent in honeybees, Gr21a orthologs in mosquitoes show divergent behavioral outputs (attraction vs. aversion) .

Challenges and Future Directions

  • Structural Resolution: The exact stoichiometry of Gr21a/Gr63a complexes remains unresolved.

  • Ligand Specificity: Many odorants activating endogenous neurons (e.g., 1-hexanol) do not directly bind Gr21a/Gr63a, suggesting auxiliary proteins mediate these responses .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Gr21a; GR21D.1; CG13948; Gustatory and odorant receptor 21a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-454
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr21a
Target Protein Sequence
MTFLDRTMSFWAVSRGLTPPSKVVPMLNPNQRQFLEDEVRYREKLKLMARGDAMEEVYVR KQETVDDPLELDKHDSFYQTTKSLLVLFQIMGVMPIHRNPPEKNLPRTGYSWGSKQVMWA IFIYSCQTTIVVLVLRERVKKFVTSPDKRFDEAIYNVIFISLLFTNFLLPVASWRHGPQV AIFKNMWTNYQYKFFKTTGSPIVFPNLYPLTWSLCVFSWLLSIAINLSQYFLQPDFRLWY TFAYYPIIAMLNCFCSLWYINCNAFGTASRALSDALQTTIRGEKPAQKLTEYRHLWVDLS HMMQQLGRAYSNMYGMYCLVIFFTTIIATYGSISEIIDHGATYKEVGLFVIVFYCMGLLY IICNEAHYASRKVGLDFQTKLLNINLTAVDAATQKEVEMLLVAINKNPPIMNLDGYANIN RELITTNISFMATYLVVLLQFKITEQRRIGQQQA
Uniprot No.

Target Background

Function
Gustatory and odorant receptor 21a (Gr21a) is a chemosensory receptor in Drosophila melanogaster that mediates acceptance or avoidance behavior in response to various substrates. Gr21a, in conjunction with Gr63a, is essential for carbon dioxide detection and subsequent avoidance behavior. The CO2 receptors, Gr63a and Gr21a, potentially activate TRPC channels via Gα49B and Plc21C. This innate olfactory avoidance behavior can be inhibited by inhibitory interactions of certain odorants, such as 1-hexanol and 2,3-butanedione, with Gr21a and Gr63a.
Gene References Into Functions
  1. CO2-responsive neurons in Drosophila express a pair of chemosensory receptors, Gr21a and Gr63a, at both larval and adult life stages. PMID: 17167414
  2. Research indicates that the Gr21a gene is expressed in CO2-sensitive cells of the antenna. PMID: 18683639
  3. Studies demonstrate that the gustatory receptor gene Gr21a plays a crucial role in mediating CO2 detection in Drosophila. PMID: 18683641
Database Links

KEGG: dme:Dmel_CG13948

STRING: 7227.FBpp0077671

UniGene: Dm.26698

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in the adult labellar chemosensory neurons. Carbon dioxide-responsive neurons coexpress Gr21a and Gr63a in a pair of chemosensory receptors at both larval and adult life stages. A single bilateral neuron, expressing the Gr21a receptor, is respon

Q&A

What is Gr21a and what is its primary function in Drosophila melanogaster?

Gr21a is a seven-transmembrane-domain chemoreceptor gene that belongs to the gustatory receptor family in Drosophila melanogaster. Its primary function, when co-expressed with Gr63a, is to detect and respond to carbon dioxide (CO₂). Together, these two receptors form a heterodimeric CO₂ receptor that is highly specific and concentration-dependent in its response. This receptor system is expressed in specialized chemosensory neurons in both larval and adult stages of the fly. The simplest interpretation of available data suggests that Gr21a and Gr63a together function as the primary receptors for CO₂ detection in Drosophila, mediating a narrowly tuned and dose-dependent response to this environmental stimulus .

Where is Gr21a expressed in Drosophila melanogaster?

In Drosophila melanogaster, Gr21a is expressed in specific chemosensory neurons at both larval and adult life stages. In larvae, Gr21a is expressed in a single neuron in the terminal organ, a larval chemosensory structure. This neuron also co-expresses Gr63a, the other component of the CO₂ receptor. In adults, Gr21a is expressed in olfactory sensory neurons housed in the ab1 sensilla subtype from the large basiconic class of sensilla located on the antennae. These CO₂-responsive neurons project to the ventrally-located V-glomerulus in the antennal lobe, forming a neural circuit that mediates repulsive behavior toward CO₂ . It's important to note that in wild-type Drosophila, CO₂ receptor expression is restricted to the antennae, and not found in the maxillary palps, due to inhibitory regulation by the microRNA miR-279 and the transcription factor prospero .

How is the behavioral response to CO₂ measured in Drosophila research?

Behavioral responses to CO₂ in Drosophila can be measured using a four-field olfactometer bioassay. In this experimental setup, CO₂ is added to ambient air in one field of the olfactometer and tested against ambient air in the other fields. Individual flies are then observed for their behavioral responses. Researchers typically test different concentrations of CO₂ (ranging from 0.02% to 1% above ambient levels) to determine sensitivity thresholds. For example, adult D. melanogaster have been shown to avoid CO₂ at concentrations of 0.1-1% above ambient but do not respond to a low rise of 0.02% .

The assay can be modified to test context-dependent responses by combining CO₂ with other odors, such as apple cider vinegar, to investigate how CO₂ perception changes in different olfactory contexts. This approach has revealed sexually dimorphic responses in some experimental conditions, with females showing different behaviors than males. The same assay can be adapted to test larval responses, allowing for comparative analysis across developmental stages .

What methods are used to study Gr21a expression patterns?

Gr21a expression patterns are typically studied using promoter-GAL4 lines coupled with fluorescent reporters. Researchers generate Gr21a promoter-GAL4 constructs that drive the expression of a GFP reporter in cells where the Gr21a promoter is active. This allows for visualization of the precise cellular localization of Gr21a expression using fluorescence microscopy. To study co-expression with other receptors, such as Gr63a, researchers can introduce multiple promoter-GAL4 drivers into the same animal and observe whether expression patterns are additive or overlapping .

For quantitative analysis of expression levels, researchers use techniques such as quantitative RT-PCR on isolated antennae and RNASeq analysis. These methods allow for precise measurement of transcript abundance across different experimental conditions, developmental stages, or Drosophila species. Normalized transcript counts from RNASeq data can reveal significant differences in receptor expression that may correlate with behavioral differences .

How do Gr21a and Gr63a interact to form a functional CO₂ receptor?

Gr21a and Gr63a function together to form a heterodimeric CO₂ receptor in Drosophila. The functional interaction between these two proteins has been demonstrated through several lines of evidence. First, both receptors are consistently co-expressed in the same chemosensory neurons. Second, when ectopically co-expressed in an "empty neuron system" (a neuron that lacks endogenous odorant receptors), they confer a robust and highly specific response to CO₂ that neither receptor alone can provide .

The response to CO₂ shows an equivalent dependence on the dose of both Gr21a and Gr63a, suggesting that both proteins contribute equally to receptor function. The specificity of this interaction is highlighted by the fact that none of 39 other chemosensory receptors tested confers a comparable response to CO₂ . Mutant flies lacking Gr63a lose both electrophysiological and behavioral responses to CO₂, further confirming the essential role of both proteins in CO₂ detection .

While the exact structural basis of this interaction remains to be fully elucidated, the current evidence strongly suggests that Gr21a and Gr63a form a heterodimer that directly or indirectly responds to CO₂. This represents a unique case in insect chemoreception where two receptor proteins must be co-expressed to confer sensitivity to a specific stimulus .

What are the developmental regulations controlling Gr21a expression?

The expression of Gr21a is regulated by a complex developmental program involving multiple transcription factors and epigenetic regulators. One key regulator is the transcription factor dac (dachshund), which is involved in the specification of large basiconic sensilla that house CO₂ olfactory receptor neurons (ORNs). Species with higher Gr21a/Gr63a expression, such as D. ananassae and D. sechellia, show increased transcription of dac compared to species with reduced CO₂ sensitivity .

Epigenetic regulation also plays a crucial role through the MMB/dREAM complex, which includes proteins such as MyB, mip130, mip120, and E2f2. Within this complex, MyB and mip130 are direct regulators of Gr63a expression, while mip120 and E2f2 function as negative regulators. The histone methyltransferase su(Var)3-9 is also involved in this regulatory network. Interestingly, mip120 expression is inversely correlated with Gr63a expression across Drosophila species, with D. virilis (which shows reduced CO₂ avoidance) exhibiting increased mip120 transcription .

Additionally, the microRNA miR-279 and the transcription factor prospero act as negative regulators to prevent ectopic expression of CO₂ ORNs in the maxillary palps. Mutations in these genes result in the inappropriate development of CO₂-sensitive neurons in the maxillary palps in addition to their normal presence in the antennae .

How can the "empty neuron system" be utilized to study Gr21a function?

The "empty neuron system" is a powerful in vivo expression system for studying chemoreceptor function in Drosophila. This system utilizes olfactory neurons that have been engineered to lack their endogenous odorant receptors, creating a "blank slate" for testing the function of introduced receptors. To study Gr21a function, researchers can express Gr21a alone or in combination with Gr63a in these empty neurons and then measure the electrophysiological and behavioral responses to various stimuli .

The methodology typically involves:

  • Generating transgenic flies expressing Gr21a and/or Gr63a under the control of an appropriate promoter

  • Crossing these flies with a line containing empty neurons

  • Recording the electrophysiological responses of these neurons to CO₂ stimulation using single sensillum recordings

  • Comparing responses to controls and to neurons expressing other chemoreceptors

  • Testing the specificity of the response using various concentrations of CO₂ and potential competing ligands

This approach has revealed that Gr21a and Gr63a together confer a highly specific and dose-dependent response to CO₂, while neither receptor alone provides this function. The empty neuron system also allows for quantitative comparison of the CO₂ response with that conferred by other chemoreceptors, demonstrating the unique capacity of the Gr21a-Gr63a combination to detect CO₂ .

What evolutionary insights can be gained from comparative analysis of Gr21a across Drosophila species?

Comparative analysis of Gr21a across Drosophila species provides valuable insights into the evolution of chemosensory systems. While CO₂ generally evokes repulsive behavior across most Drosophilids, this behavior has been lost or reduced in several lineages. For example, D. virilis shows decreased repulsion from CO₂ compared to D. melanogaster, which correlates with reduced expression of Gr63a but not Gr21a in the adult antennae .

Gr21a and Gr63a are among a small number of gustatory receptor genes that have orthologs in disease vector mosquitoes such as Anopheles gambiae (GPRGR22 and GPRGR24) and Aedes aegypti. Orthologs have also been identified in the silk moth Bombyx mori and the flour beetle Tribolium castaneum. Interestingly, closely related genes have not been found in the honey bee Apis mellifera, suggesting that bees employ a different receptor for CO₂ detection .

The conservation of Gr21a and Gr63a across various insect lineages, coupled with species-specific differences in expression levels and behavioral responses, suggests that these receptors have been subject to different selective pressures depending on the ecological niche of each species. The correlation between changes in receptor expression and changes in the expression of developmental regulators like mip120 and dac suggests that evolutionary changes in CO₂ sensing may often occur through alterations in developmental gene regulatory networks rather than through changes in receptor structure or function .

What are the potential applications of understanding Gr21a function for vector control strategies?

Understanding the molecular basis of CO₂ detection through Gr21a and Gr63a has significant implications for the development of novel vector control strategies. Since many disease-transmitting insects, including mosquitoes that vector malaria, dengue, and yellow fever, use CO₂ detection to locate human hosts, targeting this sensory pathway could disrupt host-seeking behavior .

Potential applications include:

  • Development of compounds that inhibit Gr21a-Gr63a function, potentially blocking the ability of disease vectors to detect CO₂ emanations from humans

  • Design of agonists that overstimulate the CO₂ receptor, potentially causing sensory adaptation or avoidance

  • Creation of "masking" compounds that interfere with CO₂ detection without directly interacting with the receptor

  • Genetic approaches to disrupt CO₂ receptor expression or function in vector populations

The identification of mosquito orthologs of Gr21a and Gr63a (GPRGR22 and GPRGR24 in Anopheles gambiae) provides specific molecular targets for these approaches. Given that hundreds of millions of people are infected with mosquito-borne diseases annually, developing interventions that target this unique and critical olfactory pathway could significantly impact global public health efforts .

How do environmental factors influence Gr21a-mediated CO₂ perception?

This "odor background effect" demonstrates that CO₂ perception is not fixed but depends on the olfactory context. Interestingly, this context-dependent response shows sexual dimorphism, with females exhibiting different behaviors than males under certain conditions. This suggests that there may be sex-specific modulation of the CO₂ sensory pathway, potentially related to different ecological needs of male and female flies .

Additionally, developmental stage influences CO₂ sensitivity, with larvae showing similar avoidance behavior to adults but with lower sensitivity. These findings highlight the importance of considering environmental context, sex, and developmental stage when studying Gr21a-mediated CO₂ perception .

What techniques are most effective for generating and validating recombinant Gr21a constructs?

Generating and validating recombinant Gr21a constructs for functional studies requires a systematic approach:

  • Cloning and Expression Vector Selection:

    • The Gr21a coding sequence should be amplified from Drosophila cDNA using high-fidelity polymerase

    • Appropriate expression vectors depend on the experimental system: GAL4-UAS system for in vivo Drosophila studies or vectors with tissue-specific promoters for heterologous expression systems

    • Consider adding epitope tags (e.g., HA, FLAG) for detection, but carefully evaluate their potential impact on receptor function

  • Validation of Expression:

    • Quantitative RT-PCR to confirm transcript expression

    • Immunohistochemistry using antibodies against epitope tags or the receptor itself

    • In situ hybridization to visualize mRNA expression patterns

    • Western blotting to confirm protein expression and proper size

  • Functional Validation:

    • Electrophysiological recordings from neurons expressing the recombinant constructs

    • Calcium imaging to visualize neuronal activation in response to CO₂

    • Behavioral assays to test if the construct rescues phenotypes in receptor mutants

  • Co-expression with Gr63a:

    • Since functional CO₂ detection requires both Gr21a and Gr63a, constructs should be designed to allow co-expression

    • Consider using bicistronic vectors or separate constructs with compatible selection markers

    • Validate co-localization using dual-color fluorescent reporters

How can researchers address data contradictions in Gr21a studies across different Drosophila species?

When addressing contradictions in data from Gr21a studies across different Drosophila species, researchers should implement a systematic approach:

  • Standardize Experimental Conditions:

    • Use identical CO₂ concentrations, flow rates, and delivery methods

    • Control for environmental variables (temperature, humidity, time of day)

    • Ensure genetic background consistency within each species

    • Use age and sex-matched flies

  • Employ Multiple Methodological Approaches:

    • Combine behavioral, electrophysiological, and molecular techniques

    • Use both in vivo and in vitro systems when possible

    • Perform parallel experiments on multiple species simultaneously

  • Quantitative Analysis of Receptor Expression:

    • Use RNASeq with appropriate normalization methods

    • Validate with quantitative RT-PCR using species-specific primers

    • Normalize receptor expression to conserved housekeeping genes

  • Phylogenetic Analysis:

    • Consider evolutionary relationships when comparing species

    • Account for potential confounding factors related to genetic distance

    • Use ancestral state reconstruction to infer evolutionary trajectories

  • Cross-Species Functional Complementation:

    • Express Gr21a from one species in another species' genetic background

    • Test if behavioral or physiological phenotypes can be rescued

    • Identify specific amino acid residues responsible for functional differences

By implementing these approaches, researchers can better understand whether contradictions in data reflect true biological differences or methodological inconsistencies. The comparative transcriptome analysis approach used to correlate Gr63a expression with CO₂ behavior across species provides a good model for addressing such contradictions .

What are the best practices for measuring CO₂-evoked neural responses in Gr21a-expressing neurons?

Accurate measurement of CO₂-evoked neural responses in Gr21a-expressing neurons requires careful attention to technical details:

  • Single Sensillum Recording (SSR):

    • Use tungsten or glass electrodes with tip diameters appropriate for the specific sensilla type

    • Position recording electrode at the base of the sensillum and reference electrode in the eye or body

    • Deliver precisely controlled CO₂ pulses (0.1-10%) with defined duration (typically 0.5-2 seconds)

    • Maintain constant airflow through the preparation to avoid mechanical stimulation artifacts

    • Filter signals (typically 300-3000 Hz) and amplify before digitization

    • Use spike sorting algorithms to differentiate between co-housed neurons

  • Calcium Imaging:

    • Express calcium indicators (GCaMP variants) specifically in Gr21a neurons

    • Use appropriate optical setups with high sensitivity and temporal resolution

    • Establish stable baseline before stimulus delivery

    • Control for photobleaching and indicator saturation

    • Normalize responses to pre-stimulus baseline

    • Consider co-expressing red fluorescent proteins for ratiometric measurements

  • Stimulus Delivery:

    • Use gas-mixing devices that allow precise control of CO₂ concentration

    • Measure actual delivered concentrations using CO₂ sensors

    • Minimize mechanical stimulation by maintaining constant flow rates

    • Control temperature and humidity of the gas stream

    • Use inert tubing materials that don't adsorb or react with CO₂

  • Data Analysis:

    • Calculate standard response parameters: latency, peak amplitude, response duration

    • Generate dose-response curves to quantify sensitivity

    • Use appropriate statistical methods for comparing responses across conditions

    • Consider temporal dynamics of the response, not just peak values

  • Controls:

    • Test flies lacking Gr21a or Gr63a to confirm receptor specificity

    • Apply other gaseous stimuli to test response specificity

    • Perform parallel recordings from non-CO₂-responsive neurons as negative controls

    • Include wild-type flies as positive controls when testing genetic manipulations

What are the most promising areas for future Gr21a research?

Several promising research directions could significantly advance our understanding of Gr21a function and its broader implications:

  • Structural Biology of Gr21a-Gr63a Interaction:

    • Determine the three-dimensional structure of the Gr21a-Gr63a heterodimer

    • Identify the CO₂ binding site and mechanism of receptor activation

    • Investigate the structural basis for the requirement of both proteins for function

    • Explore potential interactions with other cellular proteins that might modulate function

  • Neural Circuit Analysis:

    • Map the complete connectome of Gr21a-expressing neurons

    • Identify modulatory inputs that can alter CO₂ sensitivity in different contexts

    • Investigate how CO₂ information is integrated with other sensory modalities

    • Examine sexual dimorphism in circuit architecture and function

  • Molecular Evolution:

    • Conduct comprehensive phylogenetic analysis across insect orders

    • Investigate the ancestral function of Gr21a-like receptors

    • Identify key amino acid changes that alter receptor function across species

    • Explore the co-evolution of receptor genes and their developmental regulators

  • Applications for Vector Control:

    • Screen for compounds that specifically inhibit or activate insect CO₂ receptors

    • Develop targeted approaches that affect disease vectors but not beneficial insects

    • Explore genetic intervention strategies using gene editing technologies

    • Test combination approaches targeting multiple chemosensory pathways

  • Developmental Regulation:

    • Further characterize the regulatory network controlling Gr21a/Gr63a expression

    • Investigate epigenetic mechanisms that maintain or repress receptor expression

    • Examine how environmental factors during development might influence receptor expression

    • Study the plasticity of CO₂ sensitivity across the lifespan

How might CRISPR-Cas9 technology be applied to further Gr21a functional studies?

CRISPR-Cas9 technology offers powerful new approaches for studying Gr21a function:

  • Precise Gene Editing:

    • Create point mutations in specific domains to identify functional residues

    • Generate truncated versions to map domain functions

    • Introduce reporter tags at the endogenous locus for accurate expression analysis

    • Engineer orthogonal variants to test receptor specificity

  • Regulatory Element Analysis:

    • Systematically modify promoter and enhancer regions to identify key regulatory elements

    • Create reporter constructs to visualize the activity of specific regulatory sequences

    • Test the function of candidate binding sites for transcription factors like dac

    • Investigate the role of epigenetic modifications by targeting chromatin modifiers to specific loci

  • Cross-Species Receptor Swapping:

    • Replace Drosophila Gr21a with orthologs from mosquitoes or other insects

    • Create chimeric receptors to identify regions responsible for species-specific functions

    • Introduce mosquito GPRGR22/GPRGR24 into Drosophila to test functional conservation

    • Perform reciprocal experiments in mosquito models

  • Multiplexed Screening:

    • Create CRISPR libraries targeting multiple positions in Gr21a simultaneously

    • Screen for variants with altered sensitivity, specificity, or expression patterns

    • Identify synthetic interactions by targeting multiple components in the pathway

    • Perform genome-wide screens to identify novel regulators of Gr21a function

  • In vivo Circuit Manipulation:

    • Use CRISPR to engineer cell-type specific expression of optogenetic or chemogenetic tools

    • Create conditional knockouts to study temporal requirements for Gr21a

    • Generate intersectional genetic tools to manipulate subsets of Gr21a-expressing neurons

    • Implement mosaic analysis to study cell-autonomous functions

These CRISPR-based approaches could significantly accelerate our understanding of Gr21a function, potentially leading to new insights with applications in both basic science and vector control strategies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.