Recombinant Drosophila melanogaster Gustatory receptor 5a for trehalose (Gr5a)

Shipped with Ice Packs
In Stock

Description

Introduction to Gustatory Receptor 5a

Gustatory Receptor 5a (Gr5a) is a member of a large family of G protein-coupled receptors that mediate taste perception in Drosophila melanogaster. Genetic studies have demonstrated that Gr5a is specifically required for behavioral and sensory responses to trehalose, a disaccharide comprised of two glucose molecules connected by an unusual 1,1' linkage . The recombinant form of Gr5a has been pivotal in elucidating the structure-function relationship of insect taste receptors and represents the first functionally expressed invertebrate taste receptor in heterologous systems .

Trehalose, also known as mycose, plays a particularly important role in insect physiology. It is abundant in yeasts and fungi present in fermented fruit, a primary food source for Drosophila. Moreover, trehalose serves as the principal sugar in insect hemolymph, where it regulates osmolarity and provides a readily accessible energy source during flight . The specificity of Gr5a for trehalose underscores the evolutionary importance of this sugar in insect biology.

Molecular Structure and Characteristics

The Gr5a receptor belongs to the Gr5a subfamily, which exhibits distinctive structural features compared to other gustatory receptors. Computational models suggest that Gr5a possesses a significantly larger binding pocket (approximately 2100 ų) than other gustatory receptors such as those in the Gr43a subfamily (approximately 600 ų) . This expanded cavity likely accounts for Gr5a's ability to accommodate trehalose and potentially other complex sugars.

Expression Patterns in Drosophila melanogaster

Gr5a exhibits a specific expression pattern that corresponds to its function as a trehalose taste receptor. Using Gr5a promoter-GAL4 lines with 8.5-kb genomic regions upstream of Gr5a driving expression of UAS-lacZ and UAS-GFP reporters, researchers have mapped the expression domains of this receptor .

Distribution in Taste Organs

Gr5a is widely expressed in taste neurons located in:

  1. The labellum, a primary gustatory organ of the proboscis

  2. The tarsal segments of the legs, with four to six neurons expressing Gr5a in each tarsus

No sexual dimorphism has been observed in the expression pattern, suggesting that trehalose detection is equally important for both male and female flies. Six independently derived reporter lines yielded equivalent results, confirming the consistency of this expression pattern .

One notable finding is that Gr5a is expressed in all or nearly all of the approximately 33 sensilla present on the labellum. Since each sensillum contains a single sugar-sensitive neuron that responds to various sugars, this broad expression pattern supports a model where many sugar-sensitive taste neurons express multiple receptor types .

Functional Properties as a Trehalose Receptor

Gr5a functions as a narrowly tuned receptor that responds specifically to trehalose while showing little to no activation by other sugars. This specificity has been demonstrated through both genetic studies and heterologous expression experiments .

Specificity and Sensitivity

The recombinant Gr5a receptor displays remarkable specificity for trehalose, showing minimal response to other disaccharides or monosaccharides that Drosophila commonly encounters in its natural habitat, including sucrose, fructose, and glucose . This narrow tuning contrasts with mammalian sweet receptors such as T1R2/T1R3, which respond to diverse sweet-tasting molecules including sucrose, saccharin, dulcin, and acesulfame-K .

The response threshold of recombinant Gr5a in heterologous systems appears to be lower than in taste neurons in vivo, as determined by single-unit electrophysiological recordings . Several factors may explain this difference:

  1. The measurement parameters differ (intracellular calcium levels versus action potential frequency)

  2. Access to tastants varies between systems (direct exposure versus diffusion through sensillum pores)

  3. Receptor density or signaling component concentration may be higher in heterologous expression systems

Experimental Evidence: Heterologous Expression Studies

Direct evidence for Gr5a functioning as a trehalose receptor comes from heterologous expression studies in Drosophila S2 cells. This cell line was selected due to the notorious difficulty of expressing chemosensory receptors in heterologous systems and the ability of S2 cells to support G protein-coupled receptor activation through endogenous G proteins .

Calcium Signaling in Response to Trehalose

When expressed in S2 cells and loaded with the calcium-sensitive fluorescent indicator fura-2, Gr5a confers responsiveness to trehalose application. Stimulation with 100 mM trehalose via puffer pipette evokes calcium release with the following characteristics:

  1. Response develops within approximately 5 seconds of ligand application

  2. Peak intensity is reached within approximately 15 seconds

  3. Upon removal of trehalose, intracellular calcium gradually returns to baseline levels

These responses are specific to Gr5a expression, as control cells without Gr5a show no response to trehalose. Additionally, cells expressing another gustatory receptor (Gr64f) fail to respond to trehalose, and Gr5a-expressing cells do not respond to other molecules with membrane-stabilizing properties similar to trehalose, such as glycerol and 1,2-propanediol .

G-Protein Coupling

The functional studies also provided insights into the signaling mechanism of Gr5a. The receptor appears to couple efficiently to endogenous Gq proteins in S2 cells, activating the phosphoinositide (PI) pathway. This activation leads to:

  1. Hydrolysis of PIP₂ by phospholipase C into InsP₃ and 4,5-diacylglycerol

  2. Release of Ca²⁺ from intracellular stores

  3. Detectable changes in intracellular calcium concentration

Co-transfection of S2 cells with Gr5a and promiscuous G proteins (Gα15, Gα16, or both) did not significantly increase response intensity to trehalose stimulation, supporting the hypothesis that Gr5a couples efficiently to Gq proteins .

Comparative Analysis with Other Gustatory Receptors

Gr5a belongs to a subfamily of gustatory receptors that includes Gr64a-f and Gr61a. These receptors show structural and functional relationships that provide insights into the evolution and specialization of sugar detection in Drosophila.

Relationship with Other Sugar Receptors

While Gr5a appears to function specifically as a trehalose receptor, other members of the Gr5a-related subfamily respond to different sugars. For example, Gr64a is required for behavioral responses to glucose, sucrose, and maltose . This functional diversity within a related receptor subfamily suggests evolutionary divergence to detect various nutritionally important sugars.

Table 1: Comparison of Selected Drosophila Gustatory Receptors

ReceptorSubfamilyPrimary LigandsExpression PatternBinding Pocket Size (ų)Signaling Pathway
Gr5aGr5aTrehaloseLabellum, tarsi~2100PI/Ca²⁺ pathway
Gr64aGr5aGlucose, sucrose, maltoseCo-expressed with Gr5aSimilar to Gr5aNot fully characterized
Gr43aGr43aFructoseSubset of GRNs~600Not fully characterized

The coexpression pattern of gustatory receptors provides additional insights into taste coding in Drosophila. All seven Grs most related to Gr5a (Gr64a-f and Gr61a) are expressed in Gr5a-expressing cells, whereas none of the other Grs examined were enriched in these gustatory receptor neurons (GRNs) . This coexpression pattern suggests functional cooperation between related receptors in sugar detection.

Physiological Significance of Trehalose Detection

The narrow tuning of Gr5a to trehalose reflects its critical role in Drosophila ecology and physiology. Trehalose serves multiple important functions in insect biology:

  1. It is abundant in yeasts and fungi present in fermented fruit, an important food source for Drosophila

  2. It functions as the principal sugar in insect hemolymph, where it regulates osmolarity

  3. In many winged insects, trehalose serves as an easily transported and accessible energy source metabolized during flight

The specificity of Gr5a for trehalose has implications for the mechanism of taste coding in Drosophila. If other taste receptors are similarly specific, individual tastants may be encoded largely by the activity of one or a small number of receptors, rather than through the integrated activity of many receptors each exhibiting varying degrees of response . This hypothesis is supported by the severe loss of trehalose response observed after mutation of a single receptor gene, Gr5a .

Applications in Research and Biotechnology

Recombinant Gr5a has provided valuable insights into insect taste perception and offers potential applications in various research and biotechnology fields.

Model for Structure-Function Studies

As the first functionally expressed invertebrate taste receptor, recombinant Gr5a serves as an important model for understanding the molecular basis of taste perception in insects. The successful heterologous expression of Gr5a in S2 cells has paved the way for functional characterization of other gustatory receptors using similar approaches .

The specific binding of trehalose by Gr5a also provides a model system for studying ligand-receptor interactions in G protein-coupled receptors more broadly. The narrow tuning of this receptor makes it particularly valuable for dissecting the molecular determinants of sugar recognition.

Potential Biotechnological Applications

Understanding the structure and function of insect taste receptors like Gr5a could lead to the development of novel insect control strategies. As insects rely on chemical sensing to locate food sources and suitable egg-laying sites, compounds that interfere with taste receptor function could potentially serve as safe and specific insect repellents or attractants.

Additionally, the specificity of Gr5a for trehalose suggests potential applications in biosensor development. Recombinant taste receptors could theoretically be incorporated into devices designed to detect specific sugars or other compounds in environmental or food samples.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Gr5a; GRLU.7; Tre; CG15779; Gustatory receptor 5a for trehalose; Trehalose receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr5a
Target Protein Sequence
MRQLKGRNRCNRAVRHLKIQGKMWLKNLKSGLEQIRESQVRGTRKNFLHDGSFHEAVAPV LAVAQCFCLMPVCGISAPTYRGLSFNRRSWRFWYSSLYLCSTSVDLAFSIRRVAHSVLDV RSVEPIVFHVSILIASWQFLNLAQLWPGLMRHWAAVERRLPGYTCCLQRARPARRLKLVA FVLLVVSLMEHLLSIISVVYYDFCPRRSDPVESYLLGASAQLFEVFPYSNWLAWLGKIQN VLLTFGWSYMDIFLMMLGMGLSEMLARLNRSLEQQVRQPMPEAYWTWSRTLYRSIVELIR EVDDAVSGIMLISFGSNLYFICLQLLKSINTMPSSAHAVYFYFSLLFLLSRSTAVLLFVS AINDQAREPLRLLRLVPLKGYHPEVFRFAAELASDQVALTGLKFFNVTRKLFLAMAGTVA TYELVLIQFHEDKKTWDCSPFNLD
Uniprot No.

Target Background

Function
Gustatory receptor 5a (Gr5a) is a receptor necessary for the detection of the sugar trehalose in Drosophila taste neurons. Gr5a neurons exhibit selective responsiveness to sugars, unlike Gr66a neurons, which respond to bitter compounds. The attraction of flies to sugars and their avoidance of bitter substances suggests that Gr5a neuron activity is crucial for mediating acceptance behavior. Sugar signal transduction is facilitated by coupling with G-proteins such as Gα49B and Gαs60A.
Gene References Into Functions
  1. Gr5a detection of sugar is essential for food-induced male aggression. PMID: 25162609
  2. Gr5a is required for normal trehalose detection. PMID: 19174988
  3. Gr5a is expressed in taste sensilla neurons on the labellum and legs. PMID: 14523229
  4. Studies have examined nucleotide variation patterns in the Gr5a gene. PMID: 15342513
  5. Research has analyzed trehalose sensitivity in Drosophila gustatory receptor neurons expressing wild-type, mutant, and ectopic Gr5a. PMID: 15738154
  6. P-element insertions near Gr5a affect fitness traits, including nutrient intake, lifespan, and stress resistance. PMID: 16783380
  7. Gustatory receptors, including Gr5a, are candidate sugar receptors involved in responses to attractive tastants. PMID: 17715294
  8. Gr5a and Gr64a appear to function independently within sugar neurons and are primary receptors for sugar detection on the labellum. PMID: 17988633
Database Links

KEGG: dme:Dmel_CG15779

STRING: 7227.FBpp0070768

UniGene: Dm.19453

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr5a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in labellar chemosensory neurons.

Q&A

What is Drosophila melanogaster Gustatory receptor 5a (Gr5a)?

Gr5a is a member of a large family of G protein-coupled receptor genes that functions as a taste receptor in Drosophila melanogaster. It specifically encodes a receptor that is tuned to trehalose, a disaccharide sugar composed of two glucose molecules connected by an unusual 1,1′ linkage. Gr5a belongs to the larger Gr (gustatory receptor) family comprising at least 56 members in Drosophila, many of which are expressed in subsets of taste neurons in different taste organs . This receptor is significant as it represents the first functionally expressed invertebrate taste receptor and provides valuable insights into taste perception mechanisms.

How does the Gr5a gene relate to the Tre locus in Drosophila?

The Gr5a gene maps to the X chromosome locus called Tre, whose alleles confer differing levels of sensitivity to trehalose. Genetic studies have confirmed that Gr5a is necessary for trehalose response in vivo. Deletion mutants of Gr5a have a greatly diminished response to trehalose when assayed by electrophysiological recordings from single taste sensilla or by behavioral tests. This defect can be rescued by reintroducing a functional copy of Gr5a on a transgene, but not by introducing a mutant copy of Gr5a . These findings established the direct link between the Gr5a gene and the previously identified Tre locus.

Why is trehalose particularly important for Drosophila melanogaster?

Trehalose plays a critical role in insect physiology for several reasons:

  • It is abundant in yeasts and fungi present in fermented fruit, which constitute an important food source for Drosophila.

  • It serves as the principal sugar found in insect hemolymph, where it is involved in regulating osmolarity.

  • In many winged insects, trehalose functions as an easily transported and accessible energy source metabolized during flight .

The ability to detect trehalose through dedicated receptors like Gr5a therefore has significant ecological and physiological relevance for Drosophila melanogaster, allowing them to identify nutritionally valuable food sources and potentially regulate internal trehalose levels.

Where exactly is Gr5a expressed in Drosophila melanogaster?

Gr5a is primarily expressed in the gustatory neurons of two main structures:

  • The labellum (a gustatory organ of the proboscis): Expression is observed in most, if not all, of the approximately 33 sensilla present on the labellum.

  • The tarsal segments of the legs: Expression is detected in four to six neurons in the tarsi .

This expression pattern is consistent with the physiological function of Gr5a in detecting trehalose in food sources. The broad expression in labellar sensilla suggests that many sugar-sensitive taste neurons express multiple receptors, with Gr5a specifically mediating trehalose response while other receptors handle different sugars .

What techniques can be used to visualize Gr5a expression in Drosophila tissues?

Due to difficulties with direct in situ hybridization for most Gr genes, researchers typically employ reporter gene systems to visualize Gr5a expression:

  • GAL4-UAS System: An 8.5-kb genomic region upstream of Gr5a can be used as a promoter to drive GAL4 expression, which in turn activates reporter genes. Specifically:

    • GAL4 can drive expression of UAS-lacZ for β-galactosidase staining

    • GAL4 can drive expression of UAS-mCD8:GFP for visualization using confocal microscopy

  • Confocal microscopy: For optimal visualization, flies carrying two copies of Gr5a-GAL4 and two copies of UAS-mCD8:GFP are typically examined using this technique .

These approaches have proven effective for mapping the expression pattern of Gr5a when direct detection methods have failed.

Is there sexual dimorphism in Gr5a expression patterns?

Based on experimental evidence using Gr5a promoter-GAL4 lines, no sexual dimorphism has been observed in the expression pattern of Gr5a. Both male and female Drosophila melanogaster express Gr5a in taste neurons of the labellum and tarsi with equivalent patterns. This consistency has been confirmed across six independently derived lines . The lack of sexual dimorphism suggests that trehalose detection serves equally important functions in both sexes, likely related to identifying nutritional food sources rather than sex-specific behaviors.

How specifically is Gr5a tuned to trehalose compared to other sugars?

Gr5a exhibits remarkably narrow tuning to trehalose with minimal responsiveness to other sugars. Experimental testing of various disaccharides reveals:

Sugar TypeStructureGlycosidic BondResponse in Gr5a-expressing Cells
TrehaloseTwo glucose units1,1′ α,αStrong response
MaltoseTwo glucose units1,4′Little to no response
SucroseGlucose + fructose1,2′Little to no response
IsotrehaloseTwo glucose units1,1′ β,βNo significant response
NeotrehaloseTwo glucose units1,1′ α,βNo significant response
D-glucoseMonosaccharideN/ANo detectable response

This high specificity implies that Gr5a recognizes moieties close to the 1α,1′α glycosidic bond of trehalose . This narrow tuning is in contrast to mammalian sweet receptors, which respond to diverse sweet-tasting molecules.

What is the dose-response relationship of Gr5a to trehalose?

Gr5a displays a steep dose-dependent response to trehalose over a range of concentrations:

  • Weak responses occur at 25 μM trehalose

  • Robust responses develop in the low millimolar range

  • Saturation is observed at higher concentrations

  • The calculated Hill coefficient is nH = 1.92

This dose-response relationship provides important insights into the sensitivity of the receptor and its potential physiological relevance, as it corresponds to concentrations that might be encountered in natural food sources.

Does Gr5a function as a monomer or multimer?

Unlike mammalian sweet taste receptors that function as heterodimers (typically T1R2/T1R3), Gr5a appears to form homodimers composed of two identical Gr5a protein subunits. This represents a distinct evolutionary approach to taste reception between insects and mammals .

How can recombinant Gr5a be functionally expressed in heterologous systems?

A successful protocol for heterologous expression of Gr5a includes the following steps:

  • cDNA Preparation: Amplify a 1.2-kb fragment of full-length Gr5a cDNA from head mRNA using the Smart RACE cDNA Amplification kit or similar technology.

  • Vector Construction: Insert the fragment into an expression vector with an inducible promoter (e.g., pRmHa3 vector).

  • Cell Line Selection: Drosophila S2 cells are recommended as they provide a native cellular environment compatible with Drosophila receptors.

  • Transfection:

    • Co-transfect S2 cells with the Gr5a expression construct and a marker plasmid (e.g., pIZT-V5/His encoding GFP and zeocin-resistance) at a 3:1 ratio.

    • Use a liposomal formulation such as CellFectin for transfection.

  • Induction: Induce Gr5a expression by adding 0.6 mM Cu²⁺ to the cell culture media 48 hours before experiments.

  • Verification: Confirm expression levels by RT-PCR comparing uninduced and induced cells .

This system has proven effective where other heterologous expression systems failed with insect gustatory receptors.

What methods can be used to measure Gr5a activation in cellular assays?

The calcium imaging technique has proven effective for measuring Gr5a activation:

  • Loading cells with calcium indicators:

    • Load transfected cells with 100 μM fura-2, a ratiometric calcium-sensitive dye.

  • Stimulus application:

    • Apply trehalose solutions via puffer pipette at varying concentrations.

    • Test concentrations ranging from 0.025 μM to 250 mM to generate dose-response curves.

  • Measurement parameters:

    • Monitor changes in [Ca²⁺]ᵢ using ratiometric imaging (F340/380).

    • Define response threshold (e.g., F340/380 ≥ 0.34).

    • Record temporal dynamics: response typically develops within ~5 seconds of ligand application and reaches peak intensity within ~15 seconds.

  • Controls:

    • Use untransfected S2 cells to control for non-specific effects.

    • Test cells expressing unrelated receptors (e.g., Gr64f).

    • Test structurally similar but inactive compounds (other disaccharides) .

This approach allows for quantitative assessment of receptor activation, ligand specificity, and dose-dependency.

What are the key differences between in vivo and in vitro studies of Gr5a function?

There are several important differences to consider when comparing in vivo and in vitro studies of Gr5a:

ParameterIn vitro (S2 cells)In vivo (Taste neurons)Implications
Response thresholdLower threshold to trehaloseHigher threshold in electrophysiological recordingsMay reflect differences in receptor density or measurement methods
Measurement methodCa²⁺ levelsAction potential frequencyDifferent readouts may have different sensitivity
Ligand accessCells directly bathed in tastantTastant must enter sensillum pore and diffuse into lymphEffective concentration may differ
Receptor densityPotentially higher in expression systemsNative expression levelsMay affect sensitivity and response kinetics
Coupling componentsLimited to components in S2 cellsComplete native signaling machineryMay affect downstream signal amplification
Temporal resolutionSlower Ca²⁺ dynamicsRapid electrical responsesImportant for behavioral timescales

Understanding these differences is crucial for correctly interpreting results and reconciling findings between experimental systems .

What natural variations exist in the Gr5a gene in Drosophila populations?

Natural populations of Drosophila melanogaster exhibit significant polymorphism in the Gr5a gene. A study of 152 male lines from a natural population revealed:

  • 59 segregating sites in the Gr5a gene

  • Significant linkage disequilibrium between some pairs of sites

  • A single nucleotide polymorphism (SNP) resulting in an Ala218Thr amino acid substitution that is significantly associated with trehalose sensitivity

This natural variation provides valuable material for studying structure-function relationships in taste receptors and the evolution of taste perception.

How do single amino acid changes affect Gr5a function?

The Ala218Thr substitution has been shown to have a major effect on trehalose sensitivity. Specifically:

  • Flies carrying the threonine variant at position 218 exhibit different trehalose sensitivity compared to those with alanine at this position.

  • This single amino acid change appears to alter the binding affinity or signal transduction properties of the receptor, resulting in measurable differences in behavioral and electrophysiological responses to trehalose .

This finding demonstrates how subtle genetic changes can have significant functional consequences for sensory perception and highlights critical residues for receptor function.

How does Gr5a compare structurally and functionally to mammalian taste receptors?

There are several key differences between Gr5a and mammalian taste receptors:

FeatureGr5a (Drosophila)Mammalian Sweet Receptors (e.g., T1R2/T1R3)
OligomerizationFunctions as homodimerFunctions as heterodimer
Ligand specificityNarrowly tuned to trehaloseBroadly tuned to diverse sweet compounds
Signaling mechanismLikely couples to G proteins (possibly Gq)Couples to G proteins (primarily Gα-gustducin)
Structural homologyMember of insect Gr familyMember of class C GPCRs
Expression patternIndividual neurons may express multiple receptorsDistinct taste cells express specific receptor combinations

These differences reflect the independent evolution of taste systems in insects and mammals, despite serving similar sensory functions .

How can recombinant Gr5a be used to screen for receptor modulators?

Researchers can employ the S2 cell expression system to identify compounds that modulate Gr5a function:

  • High-throughput screening methodology:

    • Grow S2-Gr5a cells in multi-well format

    • Load with calcium-sensitive dyes (preferably those suitable for plate readers)

    • Apply test compounds alone or in combination with trehalose

    • Monitor calcium responses to identify:

      • Agonists (compounds that activate the receptor)

      • Antagonists (compounds that block trehalose-induced activation)

      • Positive allosteric modulators (compounds that enhance trehalose response)

  • Structure-activity relationship studies:

    • Test trehalose analogs with systematic structural modifications

    • Correlate structural features with receptor activation profiles

    • Generate 3D models of ligand-receptor interactions

  • Validation controls:

    • Include untransfected S2 cells to control for non-specific effects

    • Test compounds on cells expressing other Gr receptors to assess specificity

    • Validate hits with electrophysiological recordings and behavioral assays

This approach can yield insights into receptor pharmacology and potentially identify compounds that selectively modulate insect taste perception.

What are the implications of Gr5a research for understanding taste coding mechanisms?

Research on Gr5a has revealed important principles about taste coding:

  • Labeled-line model: The narrow tuning of Gr5a to trehalose supports a model where individual tastants are encoded largely by the activity of one or a small number of specific receptors, rather than through the integrated activity of many broadly-tuned receptors.

  • Receptor co-expression: The observation that Gr5a is expressed in most or all labellar taste sensilla, combined with the fact that these sensilla respond to multiple sugars, suggests that individual sugar-sensitive neurons express multiple receptors.

  • Sensory integration: Mutation of Gr5a affects trehalose response but not responses to other sugars like sucrose, indicating that different sugar receptors function independently within the same cell .

These findings contribute to our understanding of how sensory information is encoded at the receptor level and processed in the nervous system, with potential applications to other sensory modalities and organisms.

How might molecular knowledge of Gr5a contribute to insect control strategies?

Understanding the molecular basis of Gr5a function could inform novel approaches to insect control:

  • Targeted attractants or repellents:

    • Design compounds that specifically activate or block insect taste receptors

    • Create targeted baits that exploit species-specific receptor preferences

    • Develop deterrents that interfere with the detection of important food sources

  • Genetic control strategies:

    • Engineer taste receptor modifications that alter feeding behavior

    • Develop gene drive systems targeting taste receptor genes to modify populations

    • Create insects with altered taste preferences to reduce crop damage

  • Evolutionary considerations:

    • Compare taste receptor sequences across insect species to identify conserved targets

    • Develop compounds that selectively affect pest species while sparing beneficial insects

    • Understand potential for resistance development through receptor mutations

These applications represent the translational potential of basic research on insect taste receptors like Gr5a.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.