Recombinant Drosophila melanogaster Gustatory receptor 68a (Gr68a)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Production

Recombinant Drosophila melanogaster Gustatory Receptor 68a (Gr68a) is a genetically engineered protein produced to study the molecular mechanisms of pheromone detection in fruit flies. Gr68a belongs to the gustatory receptor (GR) family, a class of G protein-coupled receptors (GPCRs) critical for chemosensation .

Key Production Details

ParameterSpecification
Expression SystemEscherichia coli (E. coli)
TagN-terminal His tag
Amino Acid SequenceFull-length (1-389 aa): MKIYQDIYPISKPSQIFAILPFYSGDVDD...SKVEDISQA
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Role in Drosophila Behavior

Gr68a is a male-specific receptor expressed in chemosensory neurons of ~20 gustatory bristles on the forelegs . It detects nonvolatile female pheromones, such as 7,11-heptacosadiene and 7,11-nonacosadiene, which trigger courtship behaviors .

Behavioral Phenotypes

GenotypeCourtship EfficiencyKey Observation
Wild-type malesHighRobust wing vibration and copulation attempts
Gr68a mutantsReducedProlonged latency, failure to transition from tapping to wing extension
Rescue linesRestoredNormal courtship upon reintroduction of Gr68a transgenes

Research Applications

Recombinant Gr68a enables mechanistic studies of pheromone signaling and behavior modulation:

Key Studies

ApplicationMethodologyFindings
RNA InterferenceNeuronal silencing via Gr68a-Gal4Reduced courtship initiation (p < 0.01)
CRISPR KnockoutGr68a deletion (ΔGr68a)Loss of electrophysiological response to CH503
In Vivo ImagingGCaMP5 Ca²⁺ imagingDose-dependent neuronal activation by pheromones

Challenges and Future Directions

  • Ligand Identification: Despite structural data, the exact pheromone-Gr68a binding mechanism remains unresolved .

  • Neural Circuit Mapping: Projections from Gr68a neurons to the ventrolateral protocerebrum suggest higher-order processing .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Gr68a; GR68D.1; CG7303; Gustatory receptor 68a
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Gr68a
Target Protein Sequence
MKIYQDIYPISKPSQIFAILPFYSGDVDDGFRFGGLGRWYGRLVALIILIGSLTLGEDVL FASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYL LANGFRETYSCRNLTILVTSAAGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTL LALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHMENWRELSNLIEVLCKFRYITENINCV AGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVIC SACDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFK IFSAVTTYLVILIQFKQLEDSKVEDISQA
Uniprot No.

Target Background

Function
Dsx-dependent essential component of pheromone-driven courtship behavior in *Drosophila melanogaster*. Gr68a recognizes a female pheromone crucial for the second (tapping) step of courtship, essential for efficient courtship completion and timely mating. It is also involved in the detection of the male sex pheromone CH503, transferred during mating, which subsequently inhibits further courtship attempts by other males. Gr68a-expressing neurons in the male foreleg relay signals to the suboesophageal zone (SEZ). Courtship suppression is mediated by tachykinin neuropeptide release from a cluster of 8-10 neurons within the SEZ.
Gene References Into Functions
  1. This study established a receptor-to-sensillum map of the legs and a receptor-to-neuron map. PMID: 24849350
  2. GR68a protein recognizes a female pheromone(s) essential for the second step of courtship, critical for efficient courtship completion and timely mating. PMID: 12971900
Database Links

KEGG: dme:Dmel_CG7303

STRING: 7227.FBpp0075849

UniGene: Dm.27850

Protein Families
Insect chemoreceptor superfamily, Gustatory receptor (GR) family, Gr21a subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in chemosensory neurons of about 20 male-specific gustatory bristles in the forelegs. No expression is seen in the mechanosensory neurons. In larvae, expressed in the ventral pharyngeal sense organ.

Q&A

What is the expression pattern of Gr68a in Drosophila melanogaster?

Gr68a exhibits sexually dimorphic expression, with significantly higher expression in male forelegs compared to females. Visualization using membrane-tethered GFP (UAS-mCD8::GFP) driven by Gr68a-Gal4 reveals that each male tarsal segment contains more labeled neurons than corresponding female segments. Additionally, male legs uniquely display labeled non-neuronal cells with larger, irregularly shaped membranes lacking projections. This expression pattern is consistent across multiple studies and is most prominent in the chemosensory neurons of gustatory bristles found in male forelegs .

How is Gr68a expression regulated at the genetic level?

Gr68a expression is dependent on the sex determination gene doublesex, which controls many aspects of sexual differentiation in Drosophila. This dependency explains the sexually dimorphic expression pattern observed in males versus females. The doublesex gene produces sex-specific transcription factors that regulate downstream targets including Gr68a, resulting in male-specific expression patterns in approximately 20 gustatory bristles in the forelegs .

How can recombinant Gr68a mutants be generated and verified?

Recombinant Gr68a mutants (ΔGr68a) and rescue alleles (Gr68aRes) can be generated using ends-out homologous recombination techniques. The methodology involves:

  • Using pw25-RMCE-targeting vectors for generation

  • Verification by PCR using primers specific to the vector sequence

  • Confirming loss of the Gr68a sequence by quantitative PCR

  • For rescue experiments, recombining Gr68a-Gal4 and UAS-GCaMP5 transgenes onto the ΔGr68a background

  • Verification by labeling with UAS-mCD8::GFP

This approach allows researchers to effectively manipulate Gr68a expression for functional studies while ensuring proper genetic verification .

What methods are effective for visualizing Gr68a neuronal activity?

Calcium imaging using GCaMP fluorescent reporters provides an effective methodology for visualizing Gr68a neuronal activity in response to pheromones. The technique involves:

  • Generating flies expressing UAS-GCaMP5 under control of Gr68a-Gal4

  • Exposing preparations to controlled doses of CH503 or other compounds

  • Recording changes in fluorescence (ΔF/F) over time

  • Analyzing dose-dependent responses across different cell types

  • Including appropriate controls such as inert analogs (e.g., (R)-3-Acetoxy-11, 19-octacosadiyn-1-ol)

This approach reveals that Gr68a-expressing neurons in male forelegs show dose-dependent responses to CH503, while no significant response is observed in females or in ΔGr68a mutant flies .

How does Gr68a respond to different pheromone concentrations?

Gr68a neurons exhibit a dose-dependent physiological response to CH503. Calcium imaging studies using GCaMP5 show that:

CH503 DoseNeural Response in T2 NeuronsNeural Response in T3 NeuronsResponse in ΔGr68a Mutants
50 ngModerate increase in ΔF/FModerate increase in ΔF/FNo significant response
500 ngStrong increase in ΔF/FStrong increase in ΔF/FNo significant response

Importantly, the behaviorally inert analog (R)-3-Acetoxy-11, 19-octacosadiyn-1-ol fails to elicit significant responses at any concentration. The response is sexually dimorphic, as Gr68a-expressing neurons on female forelegs do not show statistically significant responses to CH503 .

What is the relationship between Gr68a and the neuropeptide tachykinin?

The neuropeptide tachykinin is essential for the pheromone detection neural circuit involving Gr68a. Gr68a-expressing neurons on male forelegs relay pheromone information to the central brain via peptidergic neurons. The release of tachykinin from 8-10 cells within the subesophageal zone is required for the pheromone-triggered courtship suppression. This neuropeptide-modulated central brain circuit underlies the programmed behavioral response to the gustatory sex pheromone CH503 .

How can researchers reconcile contradictory findings about Gr68a's role in courtship?

The contradiction between earlier studies suggesting Gr68a detects female pheromones and newer research showing it detects male pheromone CH503 can be resolved through careful experimental design:

This methodological approach reveals that earlier findings about courtship defects likely stemmed from males' inability to detect motion rather than female pheromones .

What experimental controls are essential when studying Gr68a function?

When studying Gr68a function, several critical controls should be included:

  • Negative controls: Use ΔGr68a mutants as a baseline for loss of function

  • Rescue controls: Include Gr68aRes flies to confirm phenotypes are specifically due to Gr68a

  • Driver controls: Compare pan-neuronal (elav-Gal4) versus Gr68a-Gal4 drivers to confirm neuronal specificity

  • Chemical controls: Test structurally related but behaviorally inert compounds

  • Sex-specific controls: Compare male and female responses for sexually dimorphic effects

  • Temperature controls: For conditional activation experiments using TrpA1, compare inactive (19°C) versus active (29°C) conditions

These controls enable researchers to parse the complex dual sensory functions of Gr68a and resolve apparent contradictions in the literature .

How can researchers generate tissue-specific knockdown of Gr68a?

For tissue-specific knockdown of Gr68a expression, researchers can employ the following methodology:

  • Generate RNAi constructs (ds_Gr68a) targeting Gr68a-specific sequences

  • Use the UAS-Gal4 system with appropriate drivers:

    • Gr68a-Gal4 for gustatory neuron-specific knockdown

    • elav-Gal4 for pan-neuronal knockdown

  • Validate knockdown efficiency using qPCR to measure Gr68a transcript levels

  • Confirm specificity by demonstrating that other Gr transcripts remain unaffected

  • Verify functional knockdown through calcium imaging showing loss of CH503 response

This approach has successfully demonstrated that neuronally expressed Gr68a receptors are important for CH503 detection, as knockdown using either driver results in similar phenotypes .

What advanced imaging techniques can resolve Gr68a neural circuit functions?

Advanced imaging techniques to resolve Gr68a neural circuit functions include:

  • Dual-color calcium imaging: Simultaneously track activity in Gr68a neurons and downstream targets

  • Trans-Tango trans-synaptic tracing: Map the complete circuit from Gr68a neurons to central brain

  • PA-GFP photoactivation: Selectively label subpopulations of Gr68a neurons to trace their projections

  • Optogenetic manipulation: Combine CsChrimson activation with GCaMP imaging for input-output analysis

  • High-speed volumetric imaging: Capture whole-brain responses to Gr68a neuron activation

These techniques can help dissect how information flows from Gr68a-expressing peripheral neurons to the subesophageal zone and how tachykinin modulates this circuit, providing insights into how gustatory pheromone detection influences courtship decisions .

What factors influence the reliability of Gr68a behavioral assays?

Several factors critical for reliable Gr68a behavioral assays include:

  • Chamber dimensions: Use both small (10 mm) and large (30 mm) chambers, as size affects courtship phenotypes

  • Environmental conditions: Maintain consistent temperature, humidity, and lighting

  • Genetic background: Use isogenic backgrounds and appropriate genetic controls

  • Age standardization: Use flies of consistent age (typically 4-7 days post-eclosion)

  • Pheromone dose: Apply consistent amounts of CH503 (50-500 ng range) for dose-response studies

  • Courtship metrics: Measure multiple parameters (latency, intensity, fraction of non-maters)

  • Statistical power: Ensure adequate sample sizes for detecting significance (N>30 for behavioral assays)

Attention to these methodological details helps explain discrepancies in the literature and ensures reproducible results when studying Gr68a's complex role in courtship behavior .

What are the best approaches for synthesizing ligands for Gr68a functional studies?

For functional studies of Gr68a, researchers should consider the following approaches to ligand synthesis:

  • Stereoselective synthesis of both (3S,11Z,19Z)-CH503 and (3R,11Z,19Z)-CH503 enantiomers

  • Preparation of structurally related but behaviorally inert analogs such as (R)-3-Acetoxy-11,19-octacosadiyn-1-ol

  • Synthesis of simpler analogs like (S)-3-Acetoxy-19-octacosen-1-ol for structure-activity relationship studies

  • Chemical verification using NMR, mass spectrometry, and optical rotation

  • Purity assessment (>98%) through HPLC or GC-MS

These compounds should be dissolved in appropriate solvents (typically DMSO or ethanol) at standardized concentrations. The chemical syntheses have been previously described in the literature and can be replicated following established protocols .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.