Recombinant Drosophila melanogaster Innexin inx1 (ogre)

Shipped with Ice Packs
In Stock

Description

Biological Roles in Drosophila Development

Innexin inx1 (Ogre) is a gap junction protein essential for intercellular communication. Key functional insights include:

Functional RoleResearch FindingsReferences
Optic lobe developmentMutations cause reduced neurons in optic lobes and abnormal electroretinograms.
Epithelial morphogenesisInteracts with Inx2/Inx3; loss leads to cuticle defects and disrupted epidermal organization.
Nervous system developmentRequired for central nervous system assembly, particularly during larval stages.
Germ cell differentiationOrthologues in other insects (e.g., Anopheles gambiae) show roles in gonad development.

Key Studies:

  • Ogre Knockout (KO): Homozygous ogre KO larvae exhibit no dorsal closure defects but show optic lobe abnormalities .

  • Interaction with Inx2/Inx3: Co-expression in Xenopus oocytes yields voltage-sensitive channels distinct from Inx2-alone channels .

Research Applications

This recombinant protein is widely used in:

  • SDS-PAGE Analysis: Primary application for purity validation .

  • Functional Studies: Mechanistic investigations of gap junction dynamics and intercellular transport .

  • Antibody Production: Rabbit polyclonal antibodies against Ogre enable Western blot and ELISA .

Future Directions

Current gaps include resolving Inx1’s role in nutrient transport (e.g., GDP-L-fucose for Notch signaling) and its interplay with calcium dynamics . Structural studies using recombinant Inx1 could elucidate channel gating mechanisms.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery time estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend brief centrifugation of the vial to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Typically, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ogre; inx1; l(1)ogre; CG3039; Innexin inx1; Innexin-1; Protein optic ganglion reduced; Protein ogre
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
ogre
Target Protein Sequence
MYKLLGSLKSYLKWQDIQTDNAVFRLHNSFTTVLLLTCSLIITATQYVGQPISCIVNGVP PHVVNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQA MACYTPKFLWNKFEGGLMRMIVMGLNITICTREEKEAKRDALLDYLIKHVKRHKLYAIRY WACEFLCCINIIVQMYLMNRFFDGEFLSYGTNIMKLSDVPQEQRVDPMVYVFPRVTKCTF HKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFWFWILLVLLIGLIVFRGCIIFMPKFRP RLLNASNRMIPMEICRSLSRKLDIGDWWLIYMLGRNLDPVIYKDVMSEFAKQVEPSKHDR AK
Uniprot No.

Target Background

Function
Innexin 1 is a structural component of gap junctions. It plays a crucial role in the generation and/or maintenance of postembryonic neuroblasts and the normal development of the optic lobe.
Gene References Into Functions
  1. Innexin 1 is predominantly localized to the baso-lateral domain of follicle cells. PMID: 19038051
Database Links

KEGG: dme:Dmel_CG3039

STRING: 7227.FBpp0301607

UniGene: Dm.1798

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Basolateral cell membrane. Note=Accumulates in the basolateral membrane of follicle cells in oocytes and epithelial cells in embryonic salivary gland and hindgut.
Tissue Specificity
In ovary, expressed in follicle cells. Expressed around the periphery of the embryo during cellular blastoderm formation. Repeating epidermal pattern emerges from stage 11, high levels of expression detected along the borders of each segment from stage 13

Q&A

What is Innexin inx1 (ogre) and where is it expressed?

Innexin inx1 (ogre) is one of eight innexin family members in Drosophila melanogaster that form gap junction channels. The gene was initially identified through genetic studies revealing its role in the generation and maintenance of postembryonic neuroblasts in the optic formation centers . Ogre is expressed in derivatives of all three germ layers (ectoderm, endoderm, and mesoderm) but not in the germ line . Its expression occurs during two key developmental contexts: during/shortly after the proliferative phase and during histolysis of some larval tissues . In the larval central nervous system, ogre is prominently expressed in proliferative neuroepithelia and in glial cells, where it partially colocalizes with Innexin2 (Inx2) .

How does Innexin inx1 (ogre) contribute to gap junction formation?

Unlike some innexins, Ogre alone cannot form functional homotypic gap junction channels when expressed in heterologous systems. Instead, it requires co-expression with Innexin2 (Inx2) to form functional heteromeric channels with properties distinct from Inx2 homotypic channels . This cooperative channel formation has been demonstrated through heterologous expression in paired Xenopus oocytes, where Ogre alone does not form channels, but co-expression with Inx2 reliably produces functional channels with unique electrophysiological properties . This indicates that Ogre contributes structurally to heteromeric gap junction formation rather than functioning independently.

What phenotypes result from Innexin inx1 (ogre) mutations?

Mutations in the ogre gene result in several distinct phenotypes:

  • Neural development defects: Significant reduction in the size of the larval nervous system when ogre is downregulated in glial cells .

  • Visual system abnormalities: Flies with ogre mutations have normal photoreceptor potentials but defective responses in postsynaptic cells of the optic lamina, indicated by reduction or absence of transients in the electroretinogram (ERG) .

  • Lethality: When certain ogre mutations are combined with mutations in other innexins, there can be severe viability defects, suggesting functional cooperation between different innexins .

Table 1: Comparison of Innexin inx1 (ogre) and ShakB mutant phenotypes in visual system

Parameterogre mutantshakB mutant
Photoreceptor potentialNormalNormal
ERG transientsReduced/absentReduced/absent
Required inPresynaptic cells (retinal photoreceptors)Postsynaptic cells
Rescue timingPupal development onlyPupal development only

What methods are effective for cloning and expressing recombinant Innexin inx1 (ogre)?

Cloning Innexin inx1 (ogre) requires careful consideration of its isoforms. Researchers have successfully employed RT-PCR using primer pairs complementary to the 5'- and 3'-ends of known isoforms . Multiple isoforms have been identified for several innexins, including two for inx1: the previously known C16E9.4a and a novel isoform (GenBank KF137642) . For expression studies, several systems have proven effective:

  • Xenopus oocyte expression system: This has been the gold standard for functional analysis of gap junction properties. Co-injection of ogre mRNA with inx2 mRNA into paired Xenopus oocytes enables electrophysiological characterization of heteromeric channels .

  • Transgenic Drosophila expression: For in vivo studies, expression using the GAL4-UAS system allows tissue-specific expression of wild-type or tagged versions of ogre . Expression under the control of tissue-specific promoters during specific developmental windows can determine when and where ogre function is required .

  • Cell culture systems: Mammalian or insect cell lines can be used for biochemical and structural studies, though these may lack some of the native cofactors present in Drosophila.

How can I visualize and track Innexin inx1 (ogre) expression in vivo?

Several complementary approaches have proven effective for visualizing ogre expression:

  • Immunofluorescence with polyclonal anti-ogre antibodies: This allows detection of endogenous protein at the cellular and subcellular levels .

  • Promoter-GFP transcriptional fusions: By creating constructs where the ogre promoter drives GFP expression, researchers can visualize the spatial and temporal expression pattern without detecting the protein itself . This approach involves:

    • Amplifying the promoter sequence upstream of the translation initiation site

    • Cloning it into a GFP expression vector

    • Generating transgenic flies carrying this construct

  • Endogenous tagging with fluorescent proteins: CRISPR/Cas9-mediated insertion of fluorescent tags at the endogenous locus enables visualization of native expression patterns without overexpression artifacts .

  • In situ hybridization: This technique detects ogre mRNA distribution in tissues during development .

What experimental systems are most appropriate for studying Innexin inx1 (ogre) function?

The choice of experimental system depends on the specific aspects of ogre function being investigated:

  • For channel properties and protein interactions:

    • Xenopus oocyte expression system allows electrophysiological characterization of gap junction channels

    • Co-immunoprecipitation and proximity labeling techniques can identify interaction partners

  • For developmental roles:

    • Drosophila genetic models using mutations, RNAi knockdown, or CRISPR/Cas9 editing

    • Tissue-specific manipulation using the GAL4-UAS system

    • Temporal control using temperature-sensitive GAL4 or drug-inducible expression systems

  • For visual system function:

    • Electroretinogram (ERG) recordings to assess photoreceptor and lamina neuron function

    • Behavioral assays of visual function

    • Anatomical studies of neural connectivity

  • For cellular and subcellular localization:

    • Live imaging of fluorescently tagged proteins

    • Immunohistochemistry combined with confocal microscopy

    • Super-resolution microscopy for detailed channel structure

How does Innexin inx1 (ogre) cooperate with other innexins to form functional channels?

The functional interaction between Ogre and other innexins, particularly Inx2, represents a sophisticated mechanism for gap junction regulation:

  • Heteromeric channel formation: When co-expressed with Inx2, Ogre forms functional heteromeric channels with properties distinct from Inx2 homotypic channels . This suggests that Ogre and Inx2 subunits combine to form mixed hexameric hemichannels.

  • Colocalization in tissues: In the Drosophila larval central nervous system, Inx2 partially colocalizes with Ogre in proliferative neuroepithelia and in glial cells , supporting their functional interaction in vivo.

  • Functional requirements: Downregulation of either ogre or inx2 selectively in glia leads to a significant reduction in the size of the larval nervous system , indicating that both proteins are required for normal nervous system development.

  • Developmental coordination: Both ogre and inx2 are required during pupal development for proper formation of neural connections in the visual system , suggesting coordinated roles during specific developmental windows.

This cooperative channel formation may provide a mechanism for generating gap junctions with specific properties tailored to the needs of particular tissues or developmental stages.

What is the role of Innexin inx1 (ogre) in nervous system development?

Innexin inx1 (ogre) plays critical roles in nervous system development through multiple mechanisms:

  • Glial function: Ogre is crucially required in glial cells for normal postembryonic development of the central nervous system . When either ogre or inx2 is downregulated in glia, there is a significant reduction in the size of the larval nervous system.

  • Visual system development: Ogre is required in presynaptic retinal photoreceptors for normal development of functional connections with the lamina . Flies with ogre mutations have defective lamina responses despite normal photoreceptor potentials.

  • Developmental timing: Transgenic expression of ogre during pupal development (but not later) rescues connection defects in the visual system , indicating a critical developmental window for its function.

  • Broader developmental contexts: Ogre is expressed during and shortly after the proliferative phase in various tissues , suggesting roles in coordinating cell proliferation with tissue development.

  • Potential molecular mechanisms: Gap junctions formed by Ogre might mediate the passage of small signaling molecules or ions that regulate neuroblast proliferation, axon guidance, or synapse formation.

How do Innexin inx1 (ogre) channels compare structurally and functionally to vertebrate gap junction proteins?

Despite low sequence homology, Drosophila innexins and vertebrate connexins form structurally similar gap junction channels, with some notable comparisons:

  • Structural similarities:

    • Both form hexameric hemichannels that dock with hemichannels from adjacent cells

    • The first transmembrane domain is important for membrane insertion and oligomerization in both protein families

    • Both can form heteromeric and heterotypic channels

  • Functional similarities:

    • Both mediate the passage of small molecules and ions between cells

    • Both contribute to electrical coupling between cells

    • Both play critical roles in development and tissue homeostasis

  • Evolutionary relationship:

    • Innexins show some structural similarities to vertebrate pannexins , suggesting possible evolutionary connections

    • The independent evolution of these structurally similar but sequentially distinct protein families represents a remarkable case of convergent evolution

  • Functional diversification:

    • Both protein families have expanded to include multiple members with specialized functions

    • In both cases, combinations of different subunits generate channels with distinct properties

Understanding these similarities and differences provides insights into fundamental principles of gap junction biology that transcend specific protein families.

How can researchers overcome challenges in generating functional recombinant Innexin inx1 (ogre)?

Generating functional recombinant Ogre presents several challenges that can be addressed through specific methodological approaches:

  • Challenge: Ogre alone does not form functional homotypic channels

    • Solution: Co-express Ogre with Inx2 to form functional heteromeric channels

    • Approach: Design expression vectors that ensure balanced expression of both proteins

  • Challenge: Proper folding and membrane insertion

    • Solution: Include appropriate signal sequences and consider the role of the first transmembrane domain in membrane insertion

    • Approach: Use epitope tags that don't interfere with protein folding or trafficking

  • Challenge: Post-translational modifications

    • Solution: Choose expression systems that support appropriate post-translational modifications

    • Approach: Compare protein modifications in different expression systems to identify critical modifications

  • Challenge: Functional validation

    • Solution: Employ multiple complementary assays to confirm channel function

    • Approach: Combine electrophysiological recordings, dye transfer assays, and in vivo rescue experiments

  • Challenge: Protein stability

    • Solution: Optimize buffer conditions and purification protocols

    • Approach: Screen different detergents and stabilizing agents for structural studies

What strategies can resolve contradictory findings in Innexin inx1 (ogre) research?

Several strategies can help resolve contradictions in the literature:

  • Standardize experimental systems:

    • Use consistent expression systems and assay conditions across studies

    • Clearly define the specific isoforms or constructs being used

    • Consider how different cellular contexts might affect protein function

  • Employ multiple complementary methods:

    • Combine electrophysiology, imaging, and biochemical approaches

    • Use both in vitro and in vivo systems to validate findings

    • Investigate both channel-dependent and channel-independent functions

  • Genetic approaches:

    • Generate allelic series with mutations affecting different aspects of protein function

    • Use structure-function analyses to identify domains responsible for specific activities

    • Employ rescue experiments with chimeric proteins or proteins with targeted mutations

  • Temporal and spatial considerations:

    • Carefully control when and where proteins are expressed or manipulated

    • Consider developmental timing in interpreting phenotypes

    • Use temporally controlled genetic manipulations to distinguish developmental from acute effects

  • Collaborative approaches:

    • Establish consortia to standardize methods and reagents

    • Perform multi-laboratory replication studies for controversial findings

    • Share detailed protocols and reagents to facilitate reproducibility

How can researchers distinguish between gap junction-dependent and -independent functions of Innexin inx1 (ogre)?

Distinguishing between these functions requires sophisticated experimental approaches:

  • Structure-function analysis:

    • Generate mutations that specifically disrupt channel formation without affecting protein expression or localization

    • Create chimeric proteins that retain specific functions while losing others

    • Use site-directed mutagenesis targeting residues predicted to be involved in channel formation

  • Rescue experiments:

    • Test if channel-defective forms of Ogre can rescue non-channel aspects of ogre mutant phenotypes

    • Compare rescue with wild-type Ogre versus Ogre with specific functional domains mutated

  • Temporal manipulation:

    • Use temporally controlled expression to identify when Ogre function is required

    • Correlate timing requirements with known developmental events

  • Drug-based approaches:

    • Use gap junction blockers to acutely inhibit channel function

    • Compare acute pharmacological inhibition with genetic manipulation

  • Interaction studies:

    • Identify proteins that interact with Ogre and determine if these interactions depend on channel formation

    • Investigate potential signaling or structural roles distinct from channel function

What emerging technologies might advance Innexin inx1 (ogre) research?

Several cutting-edge technologies hold promise for advancing ogre research:

  • CRISPR-based technologies:

    • Precise genome editing to create specific mutations or tagged versions of ogre at the endogenous locus

    • CRISPRa/CRISPRi for spatiotemporal control of gene expression

    • Base editing for introducing specific amino acid changes without double-strand breaks

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize gap junction structure beyond the diffraction limit

    • Lattice light-sheet microscopy for high-speed, low-phototoxicity imaging of gap junction dynamics

    • Expansion microscopy to physically enlarge specimens for improved resolution

  • Optogenetic and chemogenetic tools:

    • Light-activated or drug-activated versions of Ogre to control gap junction function with high spatiotemporal precision

    • Optogenetic control of signaling pathways that regulate gap junction assembly or function

  • Single-cell technologies:

    • Single-cell RNA sequencing to identify cell populations that express ogre and how expression patterns change during development

    • Single-cell proteomics to study Ogre protein levels and modifications in different cell types

  • Structural biology approaches:

    • Cryo-electron microscopy to determine the structure of Ogre-containing gap junctions

    • Molecular dynamics simulations to understand channel gating and permeability

What are promising areas for translational research based on Innexin inx1 (ogre) findings?

Several translational research directions emerge from basic ogre research:

  • Neurodevelopmental disorders:

    • Understanding how gap junctions influence neural development could inform approaches to neurodevelopmental disorders

    • Manipulation of gap junction communication might offer therapeutic strategies for certain neurological conditions

  • Visual system disorders:

    • Insights into ogre's role in visual system development could contribute to therapies for retinal-to-brain connectivity defects

    • Targeted gap junction modulation might enhance visual system function or repair

  • Glial biology and disease:

    • The crucial role of ogre in glial cells suggests potential applications in diseases involving glial dysfunction

    • Modulation of glial gap junctions might influence neural repair or protection

  • Cancer biology:

    • Understanding how gap junctions regulate cell proliferation might suggest new approaches for targeting cancer cell growth

    • The fact that ogre is expressed during proliferative phases suggests potential relevance to cell cycle regulation

  • Comparative biology of gap junctions:

    • Insights from innexin research could inform the development of connexin-targeted therapies for human diseases

    • Fundamental principles of gap junction biology revealed through Drosophila research may have broad medical applications

How might systematic analyses of Innexin inx1 (ogre) interaction networks advance our understanding?

Systematic analyses of protein-protein interactions and genetic interactions could significantly advance our understanding of ogre biology:

  • Protein interaction mapping:

    • Comprehensive identification of proteins that interact with Ogre using proximity labeling techniques like BioID or APEX

    • Analysis of how these interactions change during development or in different tissues

    • Comparison of Ogre interaction networks with those of other innexins

  • Genetic interaction screens:

    • Systematic testing of genetic interactions between ogre and other genes to identify functional relationships

    • Enhancer/suppressor screens to identify modifiers of ogre mutant phenotypes

    • CRISPR-based screens to identify genes that influence Ogre localization or function

  • Pathway analysis:

    • Integration of protein and genetic interaction data to map the signaling pathways in which Ogre participates

    • Comparison with pathways involving other innexins to identify common and divergent mechanisms

  • Cross-species comparisons:

    • Comparison of innexin interaction networks with those of connexins and pannexins

    • Identification of evolutionarily conserved interaction modules

  • Multi-omics integration:

    • Combining proteomics, transcriptomics, and functional genomics data to build comprehensive models of Ogre function

    • Using these models to predict the consequences of perturbations and guide experimental design

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.