Recombinant Drosophila melanogaster Innexin inx2 (inx2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Inx2; prp33; CG4590; Innexin inx2; Innexin-2; Gap junction protein prp33; Pas-related protein 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Inx2
Target Protein Sequence
MFDVFGSVKGLLKIDQVCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIP LGVMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQA ILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDECKNDRKKILVDYFIGNLNRHNFYAFRF FVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTF HKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLRH LLLRARSRLAESEEVELVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSREMSGDEHSA HKRPFDA
Uniprot No.

Target Background

Function
Innexin2 is a structural component of gap junctions involved in communication between germline and somatic cells, crucial for normal oogenesis. In embryonic epidermis, it's essential for epithelial morphogenesis. It plays a role in keyhole formation during early proventriculus development in response to wingless (wg) signaling. Within follicle cells, Innexin2 promotes egg chamber formation, partially through regulating Shotgun (shg) and Bazooka (baz) at the boundary between germ cells and follicle cells. In inner germarial sheath cells, Innexin2 is required for the survival of early germ cells and cyst formation.
Gene References Into Functions
  1. Innexin2-mediated calcium flux in follicle cells stimulates endocytosis by altering Dynamin (Shibire) distribution, which is critical for precise STAT activation and, consequently, border cell specification. PMID: 28114410
  2. inx2 is necessary for the transcriptional activation of dpp and punt in the eye disc. PMID: 26455410
  3. Downregulation of either ogre or inx2 specifically in glia, through targeted expression of RNA interference transgenes, leads to a significant reduction in the size of the larval nervous system and behavioral defects in surviving adults. PMID: 23813964
  4. Data suggest that Innexin3 is a critical factor for dorsal closure and mediates the stability of Innexin1, 2 and DE-cadherin by forming a complex. PMID: 23894431
  5. Innexin2 gap junctions in somatic support cells are required for cyst formation and egg chamber formation in Drosophila. PMID: 22001874
  6. This research investigates the role of the innexin 2 and ogre genes during gastrointestinal development of the fly embryo PMID: 12064608
  7. This study examines the cellular distribution and protein-protein interactions of an innexin gap junctional channel protein (inx2) in the developing epithelia of Drosophila PMID: 15047872
  8. Innexin 2 is positioned apico-laterally as well as apically between follicle cells and germ-line cells. Innexin 2 participates in cell-cell communication via hemichannels residing in the oolemma PMID: 19038051

Show More

Hide All

Database Links

KEGG: dme:Dmel_CG4590

STRING: 7227.FBpp0070966

UniGene: Dm.3095

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Cytoplasm. Apical cell membrane. Apicolateral cell membrane. Basolateral cell membrane. Lateral cell membrane. Note=In ovary, localizes to the apicolateral membrane between follicle cells and to the apical membrane between follicle cells and germline cells. Accumulates in the apicolateral membrane of epithelial cells in the epidermis. In salivary gland cells, accumulates in the basolateral membrane. In hindgut epithelial cells, accumulates in the lateral membrane. In nurse cells, localizes around the nuclei at oogenesis stage 10a and then, during stages 10b and 11, in cytoplasmic clouds and particles which become delivered into the oocyte during nurse cell regression.
Tissue Specificity
In ovary, expressed in inner germarial sheath cells, prefollicular cells, follicle cells, nurse cells and oocytes. Expressed in embryonic epithelial cells. Expressed in foregut and hindgut from stage 11-17, segmentally repeated tracheal placodes at stage

Q&A

What is the molecular structure and function of Drosophila Innexin 2?

Innexin 2 (Inx2) is a member of the innexin family of gap junction proteins in Drosophila melanogaster. These proteins form intercellular channels that allow direct communication between adjacent cells. Structurally, Inx2 is characterized by four transmembrane domains, two extracellular loops, and cytoplasmic N- and C-terminal regions. Functionally, Inx2 forms heteromeric channels with other innexins, particularly Inx3, to create voltage-sensitive intercellular channels that facilitate the passage of small molecules and ions between cells. When expressed alone in Xenopus oocytes, Inx2 forms functional channels in approximately 40% of cell pairs, whereas co-expression with Inx3 significantly increases the reliability of channel formation .

What expression patterns does Inx2 exhibit during Drosophila development?

Inx2 shows dynamic expression patterns throughout Drosophila embryogenesis. It is prominently expressed in overlapping domains with Inx3, particularly in epidermal cells bordering each segment. During oogenesis, Inx2 is specifically expressed in the anterior follicle cells of early-stage egg chambers, including the subset that will acquire border cell fate . This localized expression suggests a role in establishing border cell identity. Temporal regulation of Inx2 expression is critical, as both insufficient and excessive Inx2 levels can disrupt normal developmental processes, particularly those requiring precise cell-cell communication .

How can recombinant Inx2 be cloned and expressed for functional studies?

For functional studies, Inx2 coding regions can be amplified from Drosophila cDNA libraries and cloned into appropriate expression vectors. For in vitro expression systems such as Xenopus oocytes, the Inx2 coding region should be cloned into vectors containing 5' and 3' untranslated regions that enhance translation efficiency, such as the SPJC2L vector containing Xenopus β-globin gene sequences. The resulting constructs should be linearized with appropriate restriction enzymes (e.g., XhoI) and transcribed in vitro using SP6 or T7 RNA polymerase in the presence of 5' cap analogs to generate capped mRNAs suitable for microinjection .

For in vivo studies in Drosophila, the Inx2 coding sequence can be cloned into UAS-containing vectors to enable expression using the GAL4-UAS system. Tagged versions (GFP, RFP) have been successfully generated and validated to study localization and function, with C-terminal tagged constructs (Inx2:RFP) demonstrating functionality similar to wildtype protein .

How does Inx2 contribute to border cell specification during Drosophila oogenesis?

Inx2 plays a crucial role in border cell (BC) specification during Drosophila oogenesis through multiple mechanisms:

  • STAT Signaling Modulation: Inx2 influences border cell fate by regulating the JAK-STAT signaling pathway. Depletion of Inx2 using RNAi results in reduced STAT activity in anterior follicle cells, leading to smaller border cell clusters with fewer cells (3.7±0.2 nuclei compared to 6.2±0.1 in controls) .

  • Receptor Endocytosis Regulation: Inx2 modulates the internalization of the Domeless receptor, which is essential for proper JAK-STAT activation. When Inx2 function is compromised, Domeless receptor distribution is altered, affecting downstream STAT gradient formation .

  • Calcium Flux Control: Inx2 regulates intercellular calcium flux in follicle cells. Live imaging with calcium reporters reveals that Inx2 depletion inhibits both the activation and transmission of calcium signals between follicle cells. This calcium signaling appears to be crucial for proper border cell specification .

Experimental validation of these mechanisms employed both loss-of-function (RNAi knockdown, mutant alleles) and gain-of-function (overexpression of wildtype or tagged Inx2) approaches, combined with detailed quantification of border cell numbers and migration efficiency .

What methods are most effective for studying Inx2-mediated gap junction functionality?

Several complementary approaches are effective for studying Inx2-mediated gap junction functionality:

ApproachApplicationAdvantagesLimitations
Paired Xenopus Oocyte SystemElectrophysiological characterization of channelsAllows controlled expression of innexins; enables precise biophysical measurementsIn vitro system may not reflect in vivo conditions
In vivo ectopic expressionAssessment of biological functionReveals physiological relevance; identifies genetic interactionsPotential developmental abnormalities mask specific effects
Calcium imagingVisualizing gap junction-mediated communicationDirect visualization of intercellular signaling in real-timeRequires specialized equipment; indirect measure of channel function
Gap junction blockersPharmacological validation1-octanol and carbenoxolone can confirm gap junction involvementMay have off-target effects; limited specificity

For the paired Xenopus oocyte system, microinjection of in vitro transcribed Inx2 mRNA (alone or with Inx3) followed by electrophysiological recording has revealed that Inx2 alone forms functional channels approximately 40% of the time, while co-expression with Inx3 results in reliable channel formation with distinct properties . For in vivo studies, the GAL4-UAS system enables tissue-specific expression or knockdown, with border cell specification serving as a sensitive readout for Inx2 function .

What genetic interactions have been identified for Inx2 in Drosophila?

Inx2 exhibits several important genetic interactions that illuminate its function:

  • Inx3 Interaction: Inx2 and Inx3 show strong functional cooperation. While ectopic expression of Inx2 or Inx3 alone has limited effects on Drosophila viability, co-expression severely reduces viability, suggesting the formation of inappropriate gap junctions when both are present .

  • Shibire (Dynamin) Interaction: Inx2 genetically interacts with Shibire (Shi), the Drosophila homolog of Dynamin involved in endocytosis. Border cell specification is further compromised when Inx2 is depleted in a Shi heterozygous background (3.25±0.3 border cells) compared to Inx2 depletion alone (4.95±0.27 border cells). This suggests cooperation between Inx2 and endocytic machinery .

  • JAK-STAT Pathway Components: Genetic interaction experiments show that Inx2 interfaces with the JAK-STAT signaling pathway, specifically influencing Domeless receptor trafficking and STAT activation. STAT activity reporters show reduced activation when Inx2 is depleted .

These interactions highlight Inx2's roles in both channel formation and cellular signaling regulation, suggesting it functions at the intersection of multiple developmental and cellular processes.

How can calcium flux through Inx2-containing gap junctions be accurately measured and quantified?

Measuring calcium flux through Inx2-containing gap junctions requires sophisticated approaches combining genetic tools, live imaging, and quantitative analysis:

  • Genetically Encoded Calcium Indicators: Express calcium reporters such as GCaMP in follicle cells using appropriate GAL4 drivers (e.g., c306-Gal4 for anterior follicle cells) to visualize calcium dynamics in real-time .

  • Ex vivo Live Imaging Setup: Dissect ovaries in imaging medium and mount them for confocal microscopy with minimal damage to maintain tissue integrity. Use climate-controlled chambers to maintain physiological conditions during imaging .

  • Mechanical Stimulation Protocol: A standardized mechanical stimulation protocol can initiate calcium waves. This involves using a micropipette to deliver a controlled stimulus to a specific follicle cell while recording the resulting calcium signal propagation .

  • Pharmacological Validation: Treat samples with gap junction blockers such as 1-octanol or carbenoxolone to confirm the calcium flux is gap junction-dependent. In Inx2-depleted follicle cells, calcium signal transmission to neighboring cells is abolished, similar to the effect seen with gap junction blockers .

  • Quantification Parameters: Key measurements include:

    • Peak intensity of calcium signals

    • Rate of signal decay

    • Propagation distance to adjacent cells

    • Temporal dynamics of the calcium wave

Analysis of these parameters reveals that Inx2 depletion results in both reduced peak intensity of calcium signals and failure of signal transmission to adjacent cells, confirming Inx2's role in intercellular calcium signaling .

What are the challenges in distinguishing between homomeric and heteromeric Inx2 channels, and how can they be overcome?

Distinguishing between homomeric (Inx2-only) and heteromeric (Inx2 with other innexins) channels presents several challenges:

  • Similar Structural Properties: Innexin family members share structural similarities, making it difficult to distinguish channel composition based on morphology alone.

  • Overlapping Expression Domains: Inx2 and Inx3 are co-expressed in many tissues, complicating the isolation of homomeric channel function in vivo .

  • Variable Channel Formation Efficiency: Inx2 alone forms channels in only ~40% of paired Xenopus oocytes, creating inherent variability in experimental outcomes .

These challenges can be addressed through:

  • Electrophysiological Fingerprinting: Detailed electrophysiological characterization in Xenopus oocytes reveals that heteromeric Inx2/Inx3 channels have distinct properties from homomeric Inx2 channels, providing a functional signature .

  • Genetic Manipulation Strategies: Using tissue-specific knockdown of individual innexins or combinatorial manipulations can help isolate the contribution of specific channel types. For example, border cell phenotypes differ between Inx2 depletion alone and combined manipulation of multiple innexins .

  • Protein Interaction Studies: Co-immunoprecipitation and proximity ligation assays can detect direct interactions between different innexin proteins, revealing potential heteromeric combinations.

  • Chimeric Constructs: Creating chimeric proteins combining domains from different innexins can help identify which regions are responsible for specific channel properties and heteromeric interactions.

What are the optimal RNAi strategies for studying Inx2 function in Drosophila?

Effective RNAi-based investigation of Inx2 function requires careful consideration of several factors:

  • Construct Selection: The TRiP JF02446 RNAi construct (Bloomington stock #29306) has been validated for specific Inx2 knockdown without predicted off-targets . This construct can be expressed using the UAS-GAL4 system.

  • Driver Selection: For studying border cell specification, the c306-Gal4 driver shows robust expression in anterior follicle cells. For broader effects, Act-Gal4 or comparable ubiquitous drivers can be used .

  • Temperature Optimization: RNAi efficiency is temperature-dependent. For strong phenotypes, maintain crosses at 29°C; for milder effects or when analyzing genetic interactions, 25°C may be more appropriate to avoid masking subtle effects .

  • Validation Approaches:

    • Confirm knockdown efficiency using immunostaining with Inx2-specific antibodies

    • Generate random flip-out clones to compare protein levels in RNAi-expressing and wild-type cells within the same tissue

    • Perform rescue experiments by co-expressing RNAi-resistant Inx2 constructs (e.g., Inx2cDNA)

  • Controls: Include appropriate genetic background controls and driver-only controls. For RNAi specificity, test multiple independent RNAi constructs targeting different regions of Inx2 to confirm consistent phenotypes .

How should experiments be designed to investigate the role of Inx2 in receptor endocytosis and signaling pathway modulation?

To investigate Inx2's role in receptor endocytosis and signaling pathway modulation, a multi-faceted experimental approach is recommended:

  • Receptor Trafficking Analysis:

    • Express fluorescently tagged receptors (e.g., Domeless:GFP) in wild-type and Inx2-depleted backgrounds

    • Quantify receptor distribution between membrane and cytoplasmic vesicles

    • Measure vesicle size, number, and subcellular localization

    • Perform pulse-chase experiments with photoconvertible tags to track receptor internalization rates

  • Endocytic Machinery Assessment:

    • Evaluate distribution of endocytic components like Shibire (Dynamin) and Clathrin using immunostaining or fluorescent fusion proteins

    • Compare cytoplasmic versus membrane localization in wild-type and Inx2-manipulated contexts

    • Use temperature-sensitive shibire alleles to temporally control endocytosis

  • Calcium Dynamics Integration:

    • Combine calcium imaging with endocytosis tracking

    • Use gap junction blockers (1-octanol or carbenoxolone) to determine how calcium flux affects receptor trafficking

    • Manipulate calcium levels independently using genetic tools (e.g., UAS-Itpr, UAS-Orai) to test sufficiency for endocytosis modulation

  • Signaling Pathway Readouts:

    • Employ transcriptional reporters for JAK-STAT pathway (e.g., 10xSTAT-GFP)

    • Quantify nuclear STAT levels using immunofluorescence

    • Assess target gene expression through qRT-PCR or RNA-seq

    • Perform epistasis experiments with constitutively active pathway components to determine where Inx2 functions in the signaling cascade

The experimental design should include appropriate controls and quantitative analysis methods to rigorously evaluate the mechanistic connections between Inx2, calcium flux, endocytosis, and signaling pathway activation.

Why might recombinant Inx2 fail to form functional channels in heterologous expression systems?

Troubleshooting non-functional recombinant Inx2 channels requires examining several potential issues:

ProblemPossible CausesSolutions
Poor protein expressionSuboptimal codon usage; Inefficient translationOptimize codons for expression system; Include enhancing UTR sequences
Incorrect protein foldingMissing chaperones; Improper disulfide bond formationCo-express relevant chaperones; Optimize redox conditions
Trafficking defectsRetention in ER/Golgi; Missing targeting signalsAdd trafficking signals; Check for ER stress markers
Absence of partner innexinsRequirement for heteromeric channelsCo-express Inx3 (increases functional channel formation from 40% to near 100%)
Post-translational modification issuesMissing glycosylation or phosphorylationUse expression systems with appropriate modification capacity

Additionally, ensure that the expression construct includes proper UTR sequences to enhance translation efficiency, as was done with the SPJC2L vector containing Xenopus β-globin gene sequences for oocyte expression systems .

How can conflicting results between in vitro and in vivo studies of Inx2 function be reconciled?

Reconciling discrepancies between in vitro and in vivo studies of Inx2 function requires systematic analysis of several factors:

  • Context-Dependent Protein Interactions:

    • In vivo, Inx2 functions in tissues expressing multiple innexin family members, particularly Inx3, creating heteromeric channels with different properties than homomeric Inx2 channels studied in vitro .

    • Solution: Perform parallel studies with both isolated Inx2 and Inx2/Inx3 combinations in vitro, and compare with tissue-specific manipulations in vivo.

  • Differential Post-Translational Modifications:

    • Trafficking, assembly, and function of Inx2 may be regulated by tissue-specific post-translational modifications absent in heterologous systems.

    • Solution: Compare Inx2 modification patterns between expression systems and native tissues using mass spectrometry or phospho-specific antibodies.

  • Secondary Effects in Complex Systems:

    • In vivo phenotypes may reflect indirect consequences of Inx2 manipulation on calcium signaling, receptor trafficking, or cell adhesion rather than direct channel function .

    • Solution: Design experiments that separate channel-dependent and channel-independent functions, such as using channel-dead Inx2 mutants that maintain protein interactions.

  • Temporal Considerations:

    • Acute manipulations in vitro versus developmental consequences in vivo can yield different outcomes.

    • Solution: Use temperature-sensitive alleles or inducible systems for temporally controlled manipulation of Inx2 function in vivo.

A comprehensive resolution approach includes parallel experiments in both systems, careful distinction between direct and indirect effects, and consideration of the biological complexity in which Inx2 normally functions .

What emerging technologies could advance our understanding of Inx2 channel dynamics and regulation?

Several cutting-edge technologies show promise for deeper insights into Inx2 biology:

  • Cryo-Electron Microscopy: High-resolution structural analysis of heteromeric Inx2/Inx3 channels would reveal the molecular basis for their functional properties and provide targets for structure-guided mutagenesis.

  • Optogenetic Tools for Gap Junction Manipulation: Development of light-controlled innexin variants would enable precise temporal and spatial control of gap junction function in vivo to dissect the immediate consequences of channel opening or closing.

  • Single-Molecule Imaging Techniques: Super-resolution microscopy combined with single-particle tracking could visualize the dynamic assembly, trafficking, and turnover of individual Inx2-containing gap junction plaques in living cells.

  • CRISPR-Based Genomic Editing: Generation of endogenous tags and precise mutations in the native inx2 locus would enable study of physiological expression levels and variants without overexpression artifacts.

  • Proteomics of Inx2 Interactome: BioID or APEX proximity labeling could identify the complete complement of Inx2-interacting proteins in different cellular contexts to discover new regulators and effectors.

  • Computational Modeling of Calcium Dynamics: Integration of experimental data into mathematical models could predict how Inx2-mediated calcium waves influence developmental patterning and cell fate decisions.

These approaches would move beyond current limitations to provide mechanistic understanding of how Inx2 integrates gap junction communication with developmental signaling pathways .

How might comparative studies of innexins across species contribute to understanding Inx2 function?

Comparative evolutionary studies of innexins offer valuable insights into Inx2 function through several approaches:

  • Functional Conservation Analysis: Testing whether innexins from other invertebrate species can rescue Drosophila inx2 mutant phenotypes would reveal evolutionarily conserved functional domains and mechanisms.

  • Divergent Channel Properties: Electrophysiological characterization of innexins from diverse species could identify specialized properties that correlate with tissue-specific functions and provide clues to structure-function relationships.

  • Co-evolution with Signaling Pathways: Comparing how innexin-JAK-STAT pathway interactions vary across species could reveal whether the role of Inx2 in receptor endocytosis is a conserved or derived function.

  • Tissue-Specific Expression Patterns: Comparative analysis of regulatory elements controlling innexin expression across species would identify conserved transcriptional mechanisms governing cell-type specificity.

  • Heteromeric Compatibility: Testing the ability of Inx2 orthologs to form heteromeric channels with Inx3 would clarify whether this cooperative relationship is evolutionarily ancient or recently evolved.

Such comparative approaches would place Drosophila Inx2 in an evolutionary context, distinguishing fundamental functions from species-specific adaptations and potentially revealing novel aspects of gap junction biology relevant to both invertebrate and vertebrate systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.