Recombinant Drosophila melanogaster Innexin inx4 (zpg)

Shipped with Ice Packs
In Stock
Cat. No.
BT2137291
Source
in vitro E.coli expression system
Synonyms
zpg; inx4; CG10125; Innexin inx4; Innexin-4; Protein zero population growth
Quick Inquiry

Description

Molecular Characterization of Recombinant Innexin inx4 (zpg)

Innexin inx4 (Zero population growth, Zpg) is a germline-specific gap junction protein encoded by the zpg gene (CG10125) in Drosophila melanogaster. The recombinant protein is produced in E. coli with an N-terminal His tag for purification and detection.

Biological Functions and Mechanisms

Innexin inx4 (Zpg) plays essential roles in germline development and epithelial morphogenesis:

Germline-Soma Interactions:

  • Germ Cell Survival: Zpg forms heterotypic gap junctions with somatic Inx2, enabling calcium flux and STAT signaling to regulate germline stem cell (GSC) maintenance and differentiation .

  • Gametogenesis: Loss of Zpg disrupts germ cell survival, leading to sterility in both sexes .

Epithelial Morphogenesis:

  • In ovarian follicle cells, Zpg partners with somatic Inx2 to mediate calcium-dependent cytoskeletal remodeling, driving cuboidal-to-squamous cell transitions .

  • This process requires precise spatiotemporal calcium signaling through Inx2-Zpg channels .

Research Applications

Recombinant Zpg is widely used to investigate gap junction biology:

Experimental Uses:

  • Functional Studies: Elucidating mechanisms of germline-soma communication .

  • Protein-Protein Interaction Assays: Identifying binding partners like Inx2 .

  • Antibody Production: Polyclonal antibodies against Zpg enable localization studies .

Germline Development:

  • Zpg Mutant Phenotype: Germ cells fail to differentiate, leading to apoptosis .

  • Cell-Autonomous Role: Zpg in germ cells regulates GSC maintenance autonomously, while somatic Inx2 controls cyst stem cell (CySC) proliferation .

Signaling Pathways:

  • Calcium Flux: Zpg-mediated calcium influx activates JAK-STAT signaling, modulating myosin distribution and adherens junction dynamics .

  • Cross-Talk with STAT: Disrupted Inx2-Zpg junctions reduce STAT activity, impairing cytoskeletal reorganization .

Future Directions

Unresolved questions include:

  • The identity of additional signaling molecules transported through Zpg channels .

  • Mechanisms of channel selectivity in different developmental contexts .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know and we will prioritize developing it for you.
Synonyms
zpg; inx4; CG10125; Innexin inx4; Innexin-4; Protein zero population growth
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-367
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
zpg
Target Protein Sequence
MYAAVKPLSKYLQFKSVHIYDAIFTLHSKVTVALLLACTFLLSSKQYFGDPIQCFGDKDM DYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVPPENRNYITYYQWVVLVLLLE SFVFYMPAFLWKIWEGGRLKHLCDDFHKMAVCKDKSRTHLRVLVNYFSSDYKETHFRYFV SYVFCEILNLSISILNFLLLDVFFGGFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKC EMYKGGPSGSSNIYDYLCLLPLNILNEKIFAFLWIWFILVAMLISLKFLYRLATVLYPGM RLQLLRARARFMPKKHLQVALRNCSFGDWFVLMRVGNNISPELFRKLLEELYEAQSLIKI PPGADKI
Uniprot No.
Q9VRX6

Target Background

Function
Innexin 4 is a structural component of gap junctions in germline cells. It plays a critical role in the differentiation and survival of germline cysts in females and spermatogonia in males. Gap junctional communication between spermatogonia and somatic cyst cells is essential for normal differentiation and survival of spermatogonia.
Gene References Into Functions
  1. In males, innexin 4 localizes to the surface of spermatogonia. In females, it localizes to germ cell surfaces. PMID: 11973283
  2. Innexin 4 was detected in the oolemma up to stage 8 and in nurse-cell membranes up to stage 12. PMID: 19038051
Database Links

KEGG: dme:Dmel_CG10125

STRING: 7227.FBpp0303218

UniGene: Dm.3496

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction. Note=Concentrated at the interface between germline and somatic support cells in spermatogonia, early spermatocytes and germ cells in the ovary.
Tissue Specificity
Expressed in nurse cells and oocyte during oogenesis. Uniform expression in imaginal wing disk and low expression in developing imaginal CNS. Expressed in embryonic pole cells and primordial germ cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.