Recombinant Drosophila melanogaster Innexin inx6 (inx6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Inx6; prp6; CG17063; Innexin inx6; Innexin-6; Gap junction protein prp6; Pas-related protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-481
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
Inx6
Target Protein Sequence
MYAAVKPLSNYLRLKTVRIYDPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSERQ ADYVQSYCWTMGTYILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYAR FISIAEGVGPETRGVTKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEV GDALIVEATYRTRLQMLTRYFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFNG FWYKYIHALAAIPVYDWNLWNLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILN EKIFAVLYVWFLFIALLAIMNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVLASAGY GDWFVLMCVSINVNPTLFRELLEQLYAKLNQARCTEPVFAEQPCQQVPQLAQVPQLFSHA KLDRCPSRNCSLLIDPTADRHSICTESSHRVTAMPTAPTLNLMAPNDEIISMDRFFHESH A
Uniprot No.

Target Background

Function
Structural components of gap junctions.
Database Links

KEGG: dme:Dmel_CG17063

UniGene: Dm.13204

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Uniform expression in the imaginal wing disk. Expressed in an outer layer of the pupal developing CNS. Also expressed in pupal retina: cone cells and primary pigment cells.

Q&A

What is the structural organization of Drosophila melanogaster Innexin inx6?

Innexin 6 belongs to the innexin family of gap junction proteins found in invertebrates. While specific Drosophila inx6 structural studies are still developing, related research on C. elegans INX-6 revealed through cryo-electron microscopy that these channels consist of a hexadecameric structure formed by two innexons of 8 subunits each . This structure bears remarkable similarity to the vertebrate connexin 26 (Cx26) gap junction channel, particularly in monomeric structural organization . The spatial distribution of two disulphide bonds formed by cysteines in the extracellular loops (EL1 and EL2) in INX-6 corresponds to two of the three disulphide bonds in Cx26 . This structural conservation suggests functional significance across evolutionary distance while maintaining invertebrate-specific properties.

How does innexin 6 differ functionally from other innexin family members?

Innexin family members exhibit distinct functional properties despite structural similarities. While the search results don't provide specific functional differences for innexin 6, research on other innexins demonstrates their specialized roles. For instance, in Drosophila, Inx1, Inx2, Inx3, and Inx7 are expressed in the ectoderm and participate in embryonic development . Inx7 specifically contributes to synchronized calcium activity between physically connected projection neurons (PNs) in the antennal lobe and is required for olfactory behavioral responses .

By comparison, innexin 6 likely has its own specialized functions in cellular communication, possibly with unique regulatory properties and tissue-specific roles. Researchers investigating innexin 6 should consider designing comparative functional assays between different innexin family members to elucidate these differences.

What expression patterns does innexin 6 show during Drosophila development?

The temporal and spatial expression patterns of innexins are critical for understanding their developmental functions. Although the search results don't specifically detail innexin 6 expression patterns, other innexins show tissue-specific expression during development. For example, Inx1, Inx2, Inx3, and Inx7 are expressed in the ectoderm during Drosophila development . Inx2 is expressed in follicle cells during oogenesis .

Researchers studying innexin 6 should employ techniques such as in situ hybridization, immunohistochemistry, and developmental transcriptomics to map its expression pattern across developmental stages and tissue types. This would provide valuable insights into potential developmental functions and regulatory mechanisms governing innexin 6 expression.

What phenotypes are associated with innexin 6 mutations or knockdowns?

Mutations in innexin genes frequently result in distinct developmental phenotypes. While specific innexin 6 mutation phenotypes aren't detailed in the search results, other innexins show characteristic defects when mutated. For instance, mutations in Drosophila inx2 or inx3 cause severe developmental defects in epithelial morphogenesis, including large holes in the cuticle or complete cuticle loss . Inx7 downregulation severely disrupts embryonic development of the nervous system .

Based on the roles of other innexins, researchers should investigate innexin 6 mutants for potential defects in cellular communication, tissue morphogenesis, and organ development. Careful phenotypic characterization across developmental stages would provide insights into innexin 6's specific functions.

How does innexin 6 interact with other innexin family members?

Innexins can form both homomeric and heteromeric channels with distinct properties. Although innexin 6-specific interactions aren't detailed in the search results, evidence from other innexins shows important heteromeric interactions. For example, in C. elegans, gap junctions composed of INX-8 and INX-9 in the soma or INX-14 and INX-21 in the germ line participate in the differentiation and proliferation of germ line stem cells .

Researchers investigating innexin 6 interactions should consider co-immunoprecipitation studies, proximity ligation assays, and FRET-based approaches to identify potential binding partners. Functional studies utilizing co-expression systems could further reveal how these interactions influence channel properties and cellular functions.

What electrophysiological properties characterize innexin 6-formed channels?

The electrophysiological properties of innexin channels are crucial for understanding their functional significance. While innexin 6-specific properties aren't detailed in the search results, studies on other innexins provide valuable comparative insights. For instance, innexons from H. medicinalis exhibit multiple subconductance states with maximal single channel conductance of 500 pS for Hm-inx2, Hm-inx3, or Hm-inx6 and ~250 pS for Hm-inx1 .

Regulatory mechanisms identified for other innexons include opening in response to mechanical stress, increased extracellular potassium concentration, membrane depolarization (+20 mV or higher), and increased cytoplasmic calcium concentrations . Channel function is attenuated by arachidonic acid, lipopolysaccharide, and cytoplasmic acidification .

Researchers studying innexin 6 should employ patch-clamp techniques on recombinant expression systems to characterize its specific conductance properties and regulatory mechanisms, which would provide valuable insights into its physiological functions.

How does the amino acid sequence of innexin 6 influence its channel properties?

Structure-function relationships are fundamental to understanding innexin channel properties. While innexin 6-specific structure-function relationships aren't detailed in the search results, studies on other innexins demonstrate that specific domains influence channel function. For example, tryptophan scanning mutagenesis assays on Drosophila Shaking-B identified that substitutions at several sites in the first transmembrane domain (H27, T31, L35, or S39) alter channel properties . Additionally, the amino terminus domain participates in the regulation of voltage gating and junctional rectification of Shaking B .

For innexin 6 research, systematic mutagenesis approaches targeting conserved and variable regions would help identify critical amino acid residues that determine its unique channel properties. Special attention should be given to transmembrane domains and cytoplasmic regions that might influence gating and conductance.

What role does innexin 6 play in Drosophila neural circuit function?

Gap junction proteins, including innexins, play crucial roles in neural circuit function. While innexin 6-specific neural functions aren't detailed in the search results, research on innexin 7 demonstrates its importance in the antennal lobe (AL) of Drosophila for synchronized calcium activity between physically connected projection neurons (PNs) . Downregulation of innexin 7 in AL PNs impairs vinegar-induced electrophysiological calcium responses and behavioral responses to this appetitive stimulus .

Researchers investigating innexin 6 in neural circuits should consider cell-type-specific knockdown approaches combined with functional calcium imaging, electrophysiology, and behavioral assays to determine its role in neural communication and circuit function. Comparative studies with other innexins would provide insights into specialized neural functions.

How do post-translational modifications regulate innexin 6 function?

Post-translational modifications (PTMs) can significantly influence protein localization, stability, and function. While innexin 6-specific PTMs aren't detailed in the search results, research on related gap junction proteins suggests potential regulatory mechanisms. Researchers investigating innexin 6 PTMs should consider:

  • Phosphorylation analysis using mass spectrometry to identify modification sites

  • Site-directed mutagenesis to create phosphomimetic or phospho-null variants

  • Pharmacological manipulation of kinase and phosphatase activities to assess functional impacts

  • Antibodies against specific PTMs to monitor modification dynamics in different cellular contexts

The resulting data would provide insights into how innexin 6 function is dynamically regulated in response to cellular signaling and environmental cues.

What evolutionary conservation patterns exist for innexin 6 across invertebrate species?

Evolutionary conservation often indicates functional importance. While innexin 6-specific evolutionary patterns aren't detailed in the search results, innexins as a family are present across diverse invertebrate phyla, including Arthropoda, Nematoda, Annelida, and Cnidaria .

Researchers studying innexin 6 evolution should conduct comprehensive phylogenetic analyses across invertebrate species to identify:

  • Conserved domains suggesting fundamental functional importance

  • Variable regions indicating species-specific adaptations

  • Selection pressures acting on different protein regions

  • Potential gene duplication and specialization events

These analyses would contextualize Drosophila innexin 6 within broader evolutionary patterns and provide insights into its fundamental versus species-specific functions.

What are the optimal expression systems for producing recombinant Drosophila innexin 6?

Choosing the appropriate expression system is critical for successful recombinant protein production. While innexin 6-specific expression systems aren't detailed in the search results, general approaches used for other innexins can be adapted. For Drosophila innexins, several expression systems have been employed:

  • Transgenic Drosophila Expression: The search results indicate successful expression of vinnexins (virus-derived innexin homologs) using the GAL4-UAS system in Drosophila . Complete cDNAs were cloned into the pUAST-attB plasmid system, and constructs were injected into embryos containing φC31 integrase and an attP landing site on the second chromosome . This approach could be adapted for innexin 6 expression.

  • Cell Culture Systems: The search results mention lepidopteran cell culture for ectopic expression of vinnexins . Additionally, baculovirus-based techniques were attempted for vinnexin expression . For innexin 6, researchers might consider Drosophila S2 cells or Sf9 insect cells for expression.

When designing expression constructs, researchers should consider adding epitope tags (e.g., the C-terminal 3X HA epitope mentioned for some vinnexins ) to facilitate detection and purification while ensuring these modifications don't interfere with protein function.

What protocols exist for functional characterization of recombinant innexin 6 channels?

Functional characterization of innexin channels requires specialized techniques. While innexin 6-specific protocols aren't detailed in the search results, several approaches used for other innexins can be adapted:

Table 1: Functional Characterization Methods for Innexin Channels

TechniqueApplicationMeasured ParametersExample from Literature
Dye Transfer AssayMeasure gap junction couplingIntercellular transfer of Lucifer YellowSignificant increase in dye transfer with Sf-inx2 expression compared to controls
Patch Clamp ElectrophysiologyCharacterize channel conductanceSingle channel conductance, subconductance statesInnexons from H. medicinalis show multiple subconductance states with maximal conductance of 500 pS for certain innexins
Calcium ImagingAssess synchronized activityCalcium transients in connected neuronsRNAi-mediated knockdown of Inx7 blocks calcium transient neuronal synchronization in cultured PNs
ATP Release AssayMeasure hemichannel functionATP efflux in response to stimuliOocytes injected with Hm-inx2 from H. medicinalis release ATP when exposed to high K+ solution

Researchers should adapt these methods for innexin 6, paying particular attention to cell-specific expression patterns and potential heteromeric interactions with other innexins.

How can CRISPR-Cas9 be utilized for studying innexin 6 function in vivo?

CRISPR-Cas9 genome editing offers powerful approaches for studying gene function. While innexin 6-specific CRISPR applications aren't detailed in the search results, researchers investigating innexin 6 should consider the following strategies:

  • Gene Knockout: Design guide RNAs targeting coding regions to create frameshift mutations or large deletions.

  • Domain-Specific Mutations: Use homology-directed repair to introduce specific mutations in functional domains (e.g., transmembrane regions, cytoplasmic domains) to study structure-function relationships.

  • Fluorescent Tagging: Insert fluorescent protein sequences in-frame with innexin 6 to visualize expression patterns and subcellular localization.

  • Conditional Mutagenesis: Implement FLP/FRT or Cre/loxP systems alongside CRISPR to achieve tissue-specific or temporally controlled mutations.

  • Transcriptional Modulation: Use CRISPRa or CRISPRi approaches to upregulate or downregulate innexin 6 expression without altering the coding sequence.

When implementing these strategies, researchers should carefully validate editing efficiency and specificity through sequencing and functional assays.

What imaging techniques are most effective for visualizing innexin 6-based gap junctions?

Visualizing gap junctions requires specialized imaging approaches. While innexin 6-specific imaging techniques aren't detailed in the search results, several approaches can be adapted:

  • Immunofluorescence Microscopy: The search results mention immunomicroscopy verification of vinnexin expression in Drosophila . For innexin 6, researchers should develop specific antibodies or use epitope-tagged constructs for detection.

  • Live Cell Imaging: For dynamic studies of gap junction formation and turnover, fluorescently tagged innexin 6 constructs could be combined with time-lapse confocal microscopy.

  • Super-Resolution Microscopy: Techniques such as STED, PALM, or STORM would provide nanoscale resolution of gap junction plaques and individual channels.

  • Electron Microscopy: For ultrastructural analysis, transmission electron microscopy can visualize gap junction plaques, while immuno-gold labeling can confirm innexin 6 localization.

  • Functional Imaging: Combining structural imaging with functional techniques like fluorescent dye transfer assays or calcium imaging would correlate structure with functional coupling.

Researchers should select imaging approaches based on their specific research questions, balancing resolution requirements with the need to preserve physiological function.

What RNAi approaches are most effective for innexin 6 knockdown studies?

RNA interference provides valuable tools for studying gene function. While innexin 6-specific RNAi approaches aren't detailed in the search results, successful RNAi strategies for other innexins can be adapted:

The search results describe effective RNAi-mediated knockdown of Innexin 7 in Drosophila projection neurons . This approach used the GAL4-UAS system, with a strain that allows expression of an RNAi targeting Inx7 under UAS control (obtained from the Vienna Drosophila Resource Center, strain ID#22949) . The knockdown specifically blocked calcium transient neuronal synchronization in cultured PNs and impaired both vinegar-induced electrophysiological calcium responses and behavioral responses to this stimulus .

For innexin 6 studies, researchers should:

  • Obtain or design UAS-RNAi constructs specifically targeting innexin 6

  • Test multiple RNAi constructs to identify those with highest knockdown efficiency

  • Use appropriate GAL4 drivers for tissue-specific or developmental stage-specific expression

  • Include proper controls (e.g., non-targeting RNAi constructs)

  • Validate knockdown efficiency at both mRNA (RT-qPCR) and protein (Western blot, immunofluorescence) levels

  • Consider potential off-target effects through transcriptomic analysis

How should researchers interpret contradictory data regarding innexin 6 channel properties?

Contradictory findings are common in channel physiology research. When encountering conflicting data about innexin 6 properties, researchers should:

  • Systematically compare methodological differences: Experimental conditions, expression systems, recording techniques, and analysis methods can significantly influence results.

  • Consider heteromeric interactions: Innexins can form heteromeric channels with distinct properties. The presence of different innexin partners could explain seemingly contradictory results.

  • Evaluate post-translational modifications: Different cellular contexts may result in distinct modification patterns that alter channel properties.

  • Assess splice variants: If innexin 6 has multiple splice variants, these could exhibit different functional properties.

  • Design decisive experiments: Targeted studies specifically designed to resolve contradictions, ideally combining multiple complementary techniques.

For example, if contradictory conductance values are reported, researchers could perform systematic comparisons under standardized conditions while carefully controlling for expression of other innexins that might form heteromeric channels.

What bioinformatic approaches can predict functional domains in innexin 6?

Computational approaches offer valuable insights into protein structure and function. For innexin 6 domain prediction, researchers should consider:

  • Multiple Sequence Alignment: Compare innexin 6 across species to identify conserved regions likely representing functional domains.

  • Structural Homology Modeling: Use the C. elegans INX-6 structure revealed by cryo-electron microscopy as a template for modeling Drosophila innexin 6.

  • Transmembrane Domain Prediction: Tools like TMHMM and Phobius can identify putative membrane-spanning regions.

  • Post-translational Modification Site Prediction: Identify potential phosphorylation, glycosylation, and other modification sites that might regulate function.

  • Protein-Protein Interaction Domain Prediction: Tools like ELM (Eukaryotic Linear Motif) can identify potential binding sites for other proteins.

  • Molecular Dynamics Simulations: Explore conformational changes and channel properties using computational simulations.

These approaches should be integrated and validated experimentally to develop a comprehensive model of innexin 6 structure-function relationships.

How can researchers determine if experimental phenotypes are directly attributable to innexin 6 dysfunction?

Establishing causality between gene dysfunction and observed phenotypes requires rigorous experimental design. Researchers should:

  • Perform Rescue Experiments: If a phenotype results from innexin 6 mutation or knockdown, expression of wild-type innexin 6 should rescue the defect. This approach was successful for other innexins, as seen in Inx2 mutants where defects were rescued when one paternal copy of Inx2 was added back to the maternal null background .

  • Use Multiple Alleles or Knockdown Constructs: Consistent phenotypes across different genetic perturbations strengthen causal relationships. The search results mention using two different RNAi strains for innexin 7 , a similar approach would be valuable for innexin 6.

  • Implement Tissue-Specific Manipulations: Use the GAL4-UAS system to manipulate innexin 6 expression in specific tissues, determining where function is required for normal development or physiology.

  • Conduct Temporal Control Experiments: Use temperature-sensitive GAL4 variants or drug-inducible systems to determine when innexin 6 function is required.

  • Perform Domain-Specific Mutations: Create mutations in specific functional domains to connect molecular function to observed phenotypes.

These approaches collectively strengthen causality arguments and provide insights into the mechanisms by which innexin 6 contributes to observed phenotypes.

What statistical approaches are most appropriate for analyzing innexin 6 electrophysiological data?

Electrophysiological data analysis requires appropriate statistical methods to account for its complex and often non-normally distributed nature. Researchers should consider:

  • Non-parametric Tests: For single channel conductance data that often doesn't follow normal distributions, non-parametric tests like Mann-Whitney (as used for dye transfer experiments with vinnexins ) are appropriate.

  • Mixed-Effects Models: For recordings from multiple cells across different animals, mixed-effects models can account for nested sources of variation.

  • Channel Kinetics Analysis: Markov modeling approaches can characterize transition probabilities between conductance states, providing insights into gating mechanisms.

  • Power Analysis: Determine appropriate sample sizes before experiments to ensure sufficient statistical power given the typically high variability in electrophysiological data.

  • Multiple Comparison Corrections: When comparing multiple experimental conditions, appropriate corrections (e.g., Bonferroni, Holm-Sidak, or false discovery rate) should be applied.

Researchers should clearly report not only statistical significance but also effect sizes and confidence intervals to facilitate interpretation of biological significance.

How can researchers integrate data from different experimental approaches to build a comprehensive model of innexin 6 function?

Developing a comprehensive understanding of innexin 6 function requires integrating diverse experimental data. Researchers should consider:

  • Multilevel Integration Framework: Organize data hierarchically from molecular interactions to cellular functions to tissue/organismal phenotypes.

  • Correlation Analysis: Identify relationships between structural features, channel properties, and biological functions across experimental systems.

  • Network Analysis: Place innexin 6 within the context of interaction networks, including other innexins, regulatory factors, and downstream effectors.

  • Comparative Analysis: Systematically compare innexin 6 with other family members to identify shared and unique features.

  • Computational Modeling: Develop mathematical models that can predict system behaviors based on experimentally determined parameters.

  • Visual Synthesis: Create visual representations integrating structural, functional, and phenotypic data to communicate the comprehensive model effectively.

This integrative approach would provide a more complete understanding of innexin 6 biology than any single experimental method could achieve, generating testable hypotheses for future investigations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.