Recombinant Drosophila melanogaster Innexin shaking-B (shakB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
shakB; Pas; shak-B; CG34358; Innexin shaking-B; Protein passover
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-372
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
shakB
Target Protein Sequence
MLDIFRGLKNLVKVSHVKTDSIVFRLHYSITVMILMSFSLIITTRQYVGNPIDCVHTKDI PEDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQ AILFYTPRWLWKSWEGGKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHNWWAYR YYVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCT FFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMR VYLFRMRFRLVRRDAIEIIVRRSKMGDWFLLYLLGENIDTVIFRDVVQDLANRLGHNQHH RVPGLKGEIQDA
Uniprot No.

Target Background

Function
Shaking-B (shakB) is a structural component of gap junctions at electrical synapses in distal and mid-depth levels in the lamina. Its Lethal isoforms form voltage-sensitive intercellular channels through homotypic interactions.
Gene References Into Functions
  1. Overexpression of ShakB(N+16) in JONs resulted in the formation of ectopic dye coupling. PMID: 27043822
  2. Tryptophan scanning was employed to investigate the first transmembrane domain (M1) of the Drosophila innexin Shaking-B(Lethal). PMID: 22098739
  3. Research findings indicate that innexins, including shakB and ogre, are not functionally interchangeable in Drosophila during photoreceptor development. PMID: 12154069
  4. Seizures induced by bang-sensitive (bas2) and bang-senseless (bss1, bss2 alleles) mutations are not suppressed by shakB2. PMID: 16192342
  5. The escape response is impaired in ShakB2 mutants, but they exhibit normal voluntary flight initiation. The escape mechanism undergoes developmental modulation following eclosion, and the GF system does not underpin voluntary flight. PMID: 17851667

Show More

Hide All

Database Links

KEGG: dme:Dmel_CG34358

UniGene: Dm.2607

Protein Families
Pannexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Tissue Specificity
Isoform Neural is expressed in synapses of giant fibers (GF), in a large thoracic cell in location of postsynaptic target and optic lobe lamina and medulla. Isoform Lethal is expressed in embryonic mesodermal derivatives. During metamorphosis, both isofor

Q&A

What is shakB and what are its primary functions in Drosophila nervous system?

shakB (shaking-B) is a gene in Drosophila melanogaster that encodes gap junction proteins belonging to the innexin family. It plays crucial roles in:

  • Formation of electrical synapses in the giant fiber (GF) system

  • Mediating electrical coupling between neurons

  • Facilitating dye-coupling between connected neurons

  • Establishing proper neuroconnectivity during development

The shakB locus produces different transcripts through differential splicing and alternative promoter usage, resulting in distinct protein isoforms with specific functions . The two main categories are "shakB (lethal)" transcripts, which are essential for viability, and "shakB (neural)" transcripts, which are non-essential but critical for proper nervous system function .

How do different shakB isoforms affect gap junction formation and neural communication?

The shakB gene produces multiple isoforms through alternative splicing, with different functional properties:

  • ShakB(N+16): The "correct" isoform for proper gap junction formation between specific neurons. When misexpressed in Johnston's Organ neurons (JONs) that don't normally form gap junctions with the giant fiber, it enables de novo dye coupling, indicating formation of functional gap junctions .

  • ShakB(N): When expressed in neurons that normally form gap junctions via ShakB(N+16), this "incorrect" isoform abolishes dye coupling, demonstrating isoform-specific effects on gap junction functionality .

This isoform specificity is critical for establishing proper neural connectivity. Experimental data shows that misexpression of ShakB(N+16) increases gap junctional plaques in JON axons, while ShakB(N) does not .

What are the characteristic phenotypes of shakB mutations in Drosophila?

shakB mutations produce several distinctive phenotypes:

  • Behavioral defects: Lack of escape jump response to light-off stimulus

  • Electrophysiological abnormalities: Failure of the giant fiber to drive the dorsal longitudinal muscle (DLM)

  • Increased latency: The giant fiber drives the tergotrochanter muscle motoneuron (TTMmn) with abnormally long latency

  • Loss of dye-coupling: Reduced or eliminated transfer of neural tracers between coupled neurons

  • Seizure resistance: Significantly higher threshold to electrically-evoked seizures (80.6 ± 8.71 V compared to wild-type)

The shakB² allele, a null mutation in the neural-specific transcript, serves as a potent seizure-suppressor mutation while still allowing fly viability .

What methods are available for studying shakB-mediated gap junctions in Drosophila?

Several complementary techniques are used to investigate shakB function:

Traditional Methods:

  • Paired electrophysiological recording: Measures electrical coupling between neurons

  • Dye microinjection: Assesses gap junction permeability through dye transfer

  • Scrape loading: Evaluates gap junction communication in tissue samples

  • FRAP (Fluorescence Recovery After Photobleaching): Measures dye diffusion through gap junctions

Advanced Methods:

  • PARIS (Photoactuatable-Recombinant-protein-mediated Inactivation of Synaptic function): A non-invasive, optogenetic method that offers subcellular resolution for mapping functional gap junctions with high specificity

PARIS advantages over traditional methods:

  • Non-invasive (relies solely on light)

  • Provides spatial information at subcellular resolution

  • Fully reversible

  • Does not require exogenous dye delivery

  • Can be used for in vivo dynamic studies of gap junction regulation

How can researchers manipulate shakB expression to study its function in neural circuits?

Multiple genetic approaches are available:

1. TARGET System for Conditional Expression:
The TARGET (temporal and regional gene expression targeting) system allows temperature-controlled expression of shakB. This system uses:

  • ELAV-GAL4 driver (pan-neuronal expression)

  • UAS-shakB transgene (for expression of wild-type shakB)

  • tubP-GAL80^ts (temperature-sensitive repressor)

Temperature shifts to 32°C at different developmental stages can activate shakB expression:

  • Embryonic/larval activation partially rescues seizure threshold (47.7 ± 2.9 V and 47.3 ± 2.6 V)

  • Pupal/adult activation fails to rescue (73.6 ± 3.3 V and 76.8 ± 4.1 V)

2. Misexpression Studies:
Using the GAL4/UAS system to express specific shakB isoforms in neurons that don't normally express them to assess functional consequences .

3. Genetic Interaction Studies:
Creating double mutants with shakB and other neurological mutations to assess suppressive or enhancing effects .

What techniques can be used to visualize and quantify shakB-containing gap junctions?

Researchers can employ multiple complementary approaches:

Visualization Techniques:

  • Immunocytochemistry using anti-ShakB antibodies to detect protein localization

  • Expressing fluorescently-tagged ShakB proteins to track in vivo distribution

  • Confocal microscopy to image gap junctional plaques in specific neural structures

Quantification Methods:

  • Dye-coupling assays using Neurobiotin (NB) or other low molecular weight tracers

  • Measurement of gap junctional plaque size and density in immunolabeled samples

  • Electrophysiological measurements of coupling coefficients between paired neurons

For example, researchers have successfully quantified gap junctions by combining these approaches to demonstrate that ShakB(N+16) misexpression increases gap junctional plaques in JON axons, while ShakB(N) does not .

How does shakB contribute to synergistic processing in sensory systems?

Recent research reveals shakB's role in sensory integration:

In the Drosophila antennal lobe (AL), shakB-mediated gap junctions are essential for synergistic processing of different olfactory stimuli. Specifically:

  • shakB forms electrical synapses among four different neural connections:

    • Excitatory local neurons (eLNs) to projection neurons (PNs)

    • PNs to PNs

    • eLNs to inhibitory local neurons (iLNs)

    • eLNs to eLNs

  • In wild-type flies, exposure to both cVA (a pheromone) and vinegar produces synergistic activation in the DA1 glomerulus

  • In shakB² mutants, this synergism is completely abolished

This demonstrates that electrical synapses formed by shakB are necessary for the integration of different sensory modalities, allowing for complex information processing in the olfactory system.

What is the relationship between shakB-mediated gap junctions and chemical synapses?

The relationship between electrical and chemical synapses formed by shakB is complex:

Structural Integration:

  • The synapse between auditory Johnston's Organ neurons (JONs) and the giant fiber (GF) is structurally mixed, containing both:

    • Cholinergic chemical synapses

    • ShakB-dependent gap junctions

Developmental Independence:

  • Contrary to initial hypotheses, shakB-mediated gap junctions do not instruct the formation of chemical synapses

  • Misexpression of ShakB(N+16) increases gap junction formation but does not increase chemical synapse formation or dendritic branching

  • In contrast, misexpression of the transcription factor Engrailed (En) increases both gap junctions and chemical synapses

Functional Evidence:

  • Immunostaining shows no association between presynaptic active zones (labeled with Brp) and new ShakB plaques

  • This indicates that the two types of synapses develop and function independently, contrary to previous hypotheses

How does shakB function as a seizure suppressor and what are its implications for neurological disorders?

shakB's role in seizure suppression has significant implications:

Seizure Suppression Profile:
The shakB² mutation suppresses seizures with remarkable specificity:

MutationEffect of shakB² on Seizure Phenotype
slamdance (sda)Complete suppression
knockdown (kdn)Complete suppression
jitterbug (jbug)Complete suppression
easily shocked (eas)Partial suppression
technical knockout (tko)Partial suppression
bang-sensitive (bas)No suppression
bang-senseless (bss)No suppression

Developmental Critical Period:

  • Rescue experiments reveal that functional gap junctions must form during embryonic/larval stages to prevent seizure susceptibility

  • Expression of shakB+ during pupal/adult stages fails to rescue the seizure-resistant phenotype

Mechanism of Suppression:
The seizure-resistance in shakB² mutants likely results from disruption of electrical coupling in specific neural pathways, preventing the synchronous activity necessary for seizure propagation.

This finding has potential relevance for understanding human epilepsies, suggesting that targeted disruption of specific gap junctions might provide therapeutic approaches for certain seizure disorders.

What controls are essential when studying shakB-mediated electrical coupling?

Critical controls for shakB studies include:

Genetic Controls:

  • Wild-type (Canton-S) flies to establish baseline seizure thresholds and gap junction function

  • Appropriate GAL4 and UAS-only controls when using the GAL4/UAS system

  • Multiple shakB alleles to confirm phenotype specificity

Isoform Controls:

  • When studying one shakB isoform (e.g., ShakB(N+16)), also test another isoform (e.g., ShakB(N)) as a comparison

  • Use of "incorrect" isoforms can serve as negative controls

Developmental Controls:

  • Temperature-shift controls when using the TARGET system

  • Stage-specific expression to determine critical periods for shakB function

Physiological Controls:

  • Testing both seizure threshold and giant fiber circuit function, as these can be dissociated

  • Comparing behavioral and electrophysiological outcomes to ensure comprehensive assessment

How can researchers address common pitfalls in interpreting shakB phenotypes?

Several challenges exist in shakB research:

Phenotypic Complexity:

  • shakB mutations affect multiple neural circuits

  • Changes in one circuit may indirectly affect others

  • Solution: Conduct circuit-specific manipulations using targeted GAL4 drivers

Developmental Effects vs. Acute Functions:

  • shakB may have developmental roles separate from its acute functions in mature circuits

  • Solution: Use temporally controlled expression systems (e.g., TARGET) to distinguish these effects

Isoform-Specific Functions:

  • Different shakB isoforms may have distinct, sometimes opposing effects

  • Solution: Conduct isoform-specific rescue experiments and comparisons

Genetic Background Effects:

  • The effect of shakB mutations may vary depending on genetic background

  • Solution: Backcross mutations to a common background for at least 5-6 generations

By addressing these potential pitfalls, researchers can more accurately interpret the complex phenotypes associated with shakB mutations and manipulations.

What new research directions are emerging in shakB/innexin gap junction biology?

Emerging research areas include:

Optogenetic Manipulation:

  • PARIS and other optogenetic tools enable unprecedented spatial and temporal precision in studying gap junction function

  • These methods allow for non-invasive, reversible, subcellular investigation of gap junctions in vivo

Computational Modeling:

  • Integration of electrophysiological data with computational models to understand how gap junctions influence network dynamics

  • Prediction of how altered gap junction function affects circuit properties

Interaction with Disease Mechanisms:

  • Investigation of how gap junctions contribute to seizure propagation or suppression

  • Potential therapeutic applications based on shakB's seizure-suppressor properties

Synaptic Plasticity:

  • Understanding how gap junctions participate in activity-dependent plasticity

  • Role of shakB in learning and memory circuits

These emerging directions highlight the continuing importance of shakB research in understanding fundamental aspects of neural circuit function and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.