Recombinant Drosophila melanogaster Mannose-P-dolichol utilization defect 1 protein homolog (CG3792)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Applications

Recombinant CG3792 is critical for functional studies due to its role in dolichol-linked oligosaccharide biosynthesis. Production protocols include:

  • Expression Systems:

    • E. coli, yeast, baculovirus, or mammalian cells .

    • Tagged variants (N- or C-terminal) for purification and detection .

  • Purity: Validated via SDS-PAGE and mass spectrometry .

Research Applications:

  • Study of congenital disorders of glycosylation (CDGs), particularly CDG-If, linked to defects in dolichol-P-mannose utilization .

  • Investigation of ER-associated glycosylation mechanisms in Drosophila models .

  • Functional complementation assays to rescue glycosylation defects in mutant cell lines .

Role in Glycosylation

CG3792 homologs (e.g., human MPDU1) are required for transferring mannose and glucose residues to lipid-linked oligosaccharides (LLOs) in the ER. Key findings include:

  • Mutations in MPDU1 cause truncated LLOs lacking glucose and mannose, leading to CDG-If .

  • CG3792 deficiency in Drosophila disrupts GPI anchor biosynthesis and C-mannosylation .

Comparative Analysis

FeatureCG3792 (Drosophila)Human MPDU1
Gene LocationChromosome 2LChromosome 17p12-13
Pathogenic MutationNot yet reportedL74S (221T→C) linked to CDG-If
Substrate SpecificityDolichol-P-mannose/glucoseIdentical

Key Studies

  1. Rescue of Lec35 Mutants:

    • Transfection of human MPDU1 into CHO Lec35 cells restored normal glycosylation, confirming functional conservation .

    • Recombinant CG3792 partially rescued glucosylation defects in Drosophila S2 cells .

  2. Phagocytosis Screen:

    • CG3792 was identified among 184 genes required for Candida albicans phagocytosis in Drosophila S2 cells, highlighting its role in immune responses .

  3. Structural Analysis:

    • PQ-loop domains mediate interaction with dolichol-P-sugars, as shown by homology modeling .

Future Directions

  • Elucidate CG3792’s role in Drosophila development and immune responses .

  • Explore therapeutic strategies for CDG-If using Drosophila models .

  • Structural studies to resolve dolichol-P-sugar flipping mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize its development.
Synonyms
CG3792; Mannose-P-dolichol utilization defect 1 protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG3792
Target Protein Sequence
MTDLIRQGALFLMSEKCYDNYFLYHNFLDVPCFKALLSKGLGLAIIAGSVLVKVPQVLKI LNSKSGEGINIVGVVLDLLAISFHLSYNFMHGYPFSAWGDSTFLAIQTVTIAVLVLFFNG RKAQSGLFLVGYVVLMYVLNSGLTPMSVLFTIQSCNIPILLVGKLSQAYTNYQAGSTGQL SAATVIMMFAGSVARIFTSIQETGDFMIILTFIASTFANSVILGQLIYYWNKPAGVKVKD SKAKKPKTKKDD
Uniprot No.

Target Background

Database Links

KEGG: dme:Dmel_CG3792

STRING: 7227.FBpp0078636

UniGene: Dm.30766

Protein Families
MPDU1 (TC 2.A.43.3) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Drosophila melanogaster CG3792 protein and what is its function?

CG3792 is the Drosophila melanogaster homolog of Mannose-P-dolichol utilization defect 1 protein (MPDU1). It belongs to the MPDU1 (TC 2.A.43.3) family and functions in the transport and utilization of mannose-P-dolichol in glycosylation pathways . The protein is 252 amino acids in length and has a molecular weight of approximately 27.5 kDa . CG3792 is involved in several glycosylation pathways including N-glycosylation, O-mannosylation, and GPI anchor biosynthesis . The protein contains integral membrane components and is characterized by the presence of 2 PQ-loop domains .

How does CG3792 compare to its human homolog MPDU1?

The human MPDU1 gene encodes a protein that functions similarly to Drosophila CG3792 in glycosylation pathways. Mutations in human MPDU1 cause congenital disorder of glycosylation type If (CDG-If) . Both proteins belong to the same MPDU1 family and share functional similarities in mannose-P-dolichol utilization processes. The conservation between these proteins makes Drosophila an effective model organism for studying MPDU1-related glycosylation disorders. Transfection with normal human MPDU1 allele has been shown to nearly completely restore glycosylation in cells with MPDU1 mutations .

What are the most effective methods for expressing recombinant CG3792 protein?

Several expression systems can be used to produce recombinant CG3792, with specific considerations for this membrane protein:

Expression SystemAdvantagesLimitationsYield Estimates
E. coliCost-effective, rapid productionMay lack proper folding for membrane proteinsVariable, often lower for membrane proteins
YeastBetter for eukaryotic proteins, some post-translational modificationsNot all Drosophila-specific modificationsModerate
BaculovirusGood for insect proteins, proper folding and modificationsMore complex and expensive than bacterial systemsHigher than bacterial systems
Mammalian CellMost complete post-translational modificationsMost expensive, slower productionVariable based on optimization
Cell-Free ExpressionRapid production, fewer toxicity issuesMay need optimization for membrane proteinsModerate

When expressing CG3792, consider using a cell-free expression system as it has been successfully used for this protein . For functional studies, baculovirus or insect cell systems may provide better biological activity due to proper protein folding and post-translational modifications. Include proper purification tags (typically His-tag) and verify expression using SDS-PAGE and Western blot with CG3792-specific antibodies .

How can I design a CRISPR knockout screen to identify genetic interactions with CG3792?

Based on previous successful CRISPR screens in Drosophila , a systematic approach would include:

  • sgRNA Library Design:

    • Generate at least four different sgRNAs per gene to mitigate sgRNA-specific effects

    • Include controls targeting essential and non-essential genes

    • Ensure genome-wide coverage of Drosophila genes

  • Experimental Setup:

    • Use Drosophila S2 cell lines for transfection with the sgRNA library

    • Create parallel conditions: control and CG3792 inhibition/knockout

    • Apply appropriate selection pressure to identify genes that modify CG3792-related phenotypes

  • Analysis Pipeline:

    • Use deep sequencing to quantify sgRNA abundance before and after selection

    • Apply statistical algorithms to identify significantly enriched or depleted sgRNAs

    • Validate top hits with individual knockout experiments

  • Validation Strategy:

    • Confirm knockout efficiency using qPCR and Western blot

    • Validate phenotypes in vivo using Drosophila genetic models

    • Assess functional outcomes related to glycosylation pathways

This approach can identify modifier genes that affect cellular survival and function when CG3792 is compromised, similar to the screens that identified Dpm1 as a modifier of DPAGT1 function .

What are appropriate positive and negative controls for CG3792 functional studies?

Positive Controls:

  • Wild-type CG3792 expression construct

  • Human MPDU1 (for functional complementation studies)

  • Known interaction partners (e.g., CG5705 as identified in protein interaction databases)

Negative Controls:

  • Empty vector controls

  • CG3792 with non-functional mutations in conserved domains

  • Non-targeting sgRNAs for CRISPR experiments

  • Pre-immune serum for antibody experiments

For glycosylation assays, include both constitutively glycosylated proteins (positive controls) and non-glycosylated proteins (negative controls) to establish assay reliability.

How can CG3792 be used as a model to study human congenital disorders of glycosylation?

CG3792 in Drosophila provides an excellent model system for studying congenital disorders of glycosylation (CDGs) for several reasons:

  • Conserved Glycosylation Machinery: Drosophila contains many orthologs of human CDG genes. Research has shown significant enrichment of CDG genes among modifiers of glycosylation pathways .

  • Experimental Advantages:

    • Shorter lifespan allows for rapid generation studies

    • Well-established genetic tools (CRISPR, RNAi, etc.)

    • Lower cost compared to mammalian models

    • Ability to screen large numbers of genetic modifiers

  • Translational Research Pipeline:

    • Identify genetic interactions in Drosophila

    • Validate in Drosophila in vivo models

    • Test in mammalian cell culture

    • Validate in patient-derived cells

What experimental approaches can detect CG3792's role in glycosylation pathways?

Several complementary approaches can be employed:

  • Mass Spectrometry-Based Glycoproteomics:

    • Compare glycopeptide profiles between wild-type and CG3792 knockout cells

    • Identify specific N- and O-linked glycosylation sites affected by CG3792 deletion

    • Quantify changes in glycan compositions and structures

  • Cell-Based Glycosylation Assays:

    • Monitor the incorporation of fluorescently labeled sugars into glycoproteins

    • Analyze surface glycoprotein levels using lectins or glycan-binding antibodies

    • Assess trafficking of glycoproteins through the secretory pathway

  • In Vitro Glycosylation Reactions:

    • Use microsomal preparations from wild-type and CG3792 knockout cells

    • Test the efficiency of glycosylation of model substrates

    • Analyze the effect of CG3792 on specific glycosyltransferase activities

  • Genetic Interaction Studies:

    • Perform genetic suppressor/enhancer screens with CG3792 mutants

    • Test double mutants with other glycosylation pathway components

    • Assess synthetic lethality with genes in parallel pathways

Similar approaches were used to identify that inhibition of mannosyltransferase Dpm1 vastly improves cell survival under the loss of DPAGT1 function and ER stress .

How can two-way ANOVA be used to analyze CG3792 expression data in microarray studies?

Two-way ANOVA is particularly valuable for microarray studies of CG3792 as it can analyze the effects of two independent variables simultaneously . For example:

What are the best approaches for detecting CG3792 protein in Drosophila tissues and cells?

Multiple detection methods can be employed depending on your research objectives:

  • Western Blot Analysis:

    • Use commercially available antibodies against CG3792

    • Optimal dilution ranges: 1:1000-1:5000 for primary antibodies

    • Include appropriate positive controls (recombinant protein) and negative controls (pre-immune serum)

    • For membrane proteins like CG3792, specialized lysis buffers containing detergents are required

  • Immunohistochemistry/Immunofluorescence:

    • Fixation: 4% paraformaldehyde for 20 minutes works well for most Drosophila tissues

    • Permeabilization: 0.1-0.3% Triton X-100 for membrane proteins

    • Antibody incubation: overnight at 4°C for primary antibodies

    • Counterstain with DAPI for nuclear visualization and phalloidin for actin cytoskeleton

  • Subcellular Fractionation:

    • Enrich for membrane fractions to concentrate CG3792

    • Verify fraction purity using markers for different cellular compartments

    • Use detergent solubilization to extract membrane-bound proteins

  • Mass Spectrometry:

    • For unbiased detection and quantification

    • Requires specialized sample preparation for membrane proteins

    • Consider targeted approaches (MRM/PRM) for higher sensitivity

When using antibodies, validate specificity using knockout controls and recombinant proteins .

How can RNA interference be optimized to study CG3792 function in Drosophila cells?

Optimizing RNAi for CG3792 studies requires careful consideration of several factors:

  • siRNA/dsRNA Design:

    • Target sequence selection: Design 3-4 independent siRNAs targeting different regions of CG3792 mRNA

    • Specificity: Check for off-target effects using genome-wide BLAST searches

    • Control siRNAs: Include non-targeting controls and positive controls targeting housekeeping genes

  • Delivery Methods:

    • For S2 cells: Direct addition of dsRNA to culture medium works well

    • For primary cells: Consider lipid-based transfection reagents

    • In vivo: Use GAL4-UAS system with tissue-specific drivers for targeted knockdown

  • Knockdown Validation:

    • qRT-PCR to measure mRNA reduction (target >70% knockdown)

    • Western blot to confirm protein reduction

    • Time course analysis to determine optimal time point after transfection

  • Phenotypic Analysis:

    • Assess glycosylation using lectins or glycoprotein-specific antibodies

    • Measure ER stress markers (e.g., XBP1 splicing, BiP upregulation)

    • Analyze cell viability and growth under various conditions

  • Rescue Experiments:

    • Co-express RNAi-resistant CG3792 variants to confirm specificity

    • Test human MPDU1 for functional complementation

This approach has been successfully used in genome-wide CRISPR screens in Drosophila cells to identify genetic interactions .

How should researchers analyze the results of a genome-wide CRISPR screen to identify CG3792 genetic interactions?

Analysis of genome-wide CRISPR screen data for CG3792 interactions requires a systematic pipeline:

  • Primary Data Processing:

    • Quality control of sequencing reads

    • Mapping reads to sgRNA reference library

    • Normalization for sequencing depth variations

  • Statistical Analysis:

    • Calculate enrichment/depletion scores for each sgRNA

    • Aggregate multiple sgRNAs targeting the same gene

    • Apply statistical tests (e.g., MAGeCK, BAGEL) to identify significant hits

    • Set appropriate FDR thresholds (typically <0.05 or <0.1)

  • Candidate Prioritization:

    • Rank genes by statistical significance and effect size

    • Focus on genes with multiple effective sgRNAs

    • Consider biological relevance to glycosylation pathways

    • Evaluate previous literature on identified candidates

  • Pathway Enrichment Analysis:

    • Perform GO term enrichment

    • Analyze protein-protein interaction networks

    • Look for enrichment of specific pathways (e.g., CDG-related genes)

  • Validation Strategy:

    • Individual validation of top candidates

    • Orthogonal assays to confirm phenotypes

    • Epistasis analysis to determine genetic relationships

A similar approach identified that knockout of multiple GPI anchor biosynthesis genes improves survival and cell surface glycoprotein levels in Drosophila S2 cells associated with DPAGT1 inhibition and ER stress .

What statistical approaches are recommended for analyzing CG3792 expression changes in time-course experiments?

For time-course experiments involving CG3792 expression:

  • Two-Way ANOVA:

    • Appropriate when comparing expression between different conditions over time

    • Can detect time-by-condition interactions, main effects of time, and main effects of condition

    • Requires normal distribution of data and homogeneity of variance

  • Linear Mixed Models:

    • Better for handling repeated measures and missing data points

    • Can incorporate random effects (e.g., biological replicates)

    • More flexible for complex experimental designs

  • Time-Series Specific Methods:

    • EDGE (Extraction of Differential Gene Expression) for time-course data

    • Autoregressive integrated moving average (ARIMA) models

    • Hidden Markov Models for state transitions

  • Non-Parametric Alternatives:

    • Kruskal-Wallis test (non-parametric alternative to ANOVA)

    • Friedman test for repeated measures

    • Particularly useful for microarray data with many outliers

  • Visualization Techniques:

    • Plot expression patterns as shown in Figure 1.5 (panels A-D)

    • Use heatmaps for genome-wide expression data

    • Principal component analysis to identify major sources of variation

When analyzing microarray data specifically, robust statistical approaches are recommended due to the abundance of missing data points that often occur .

How can CG3792 research contribute to therapeutic strategies for congenital disorders of glycosylation?

Research on CG3792 in Drosophila has several implications for therapeutic development:

This research provides new therapeutic targets for DPAGT1-CDG and potentially other glycosylation disorders, with the unique finding that Dpm1-related pathways can rescue DPAGT1 dysfunction .

What are the most promising directions for future research on CG3792?

Several promising research directions emerge from current knowledge:

These research directions could significantly advance our understanding of glycosylation disorders and lead to novel therapeutic approaches.

What are the key considerations for ensuring reproducible results when working with CG3792?

To ensure experimental reproducibility with CG3792:

  • Genetic Background Control:

    • Use isogenic fly stocks when comparing mutants

    • Backcross mutant lines to control for background mutations

    • Document the exact genotype of all strains used

  • Experimental Design Rigor:

    • Perform power analysis to determine appropriate sample sizes

    • Include all necessary controls (positive, negative, genetic background)

    • Randomize and blind samples where possible

    • Consider environmental variables (temperature, humidity, food composition)

  • Method Standardization:

    • Develop detailed protocols with precise parameters

    • Use consistent reagents and cell lines across experiments

    • Standardize data collection parameters and analysis pipelines

  • Validation Across Multiple Systems:

    • Test findings in multiple Drosophila cell lines or tissues

    • Validate key findings in other model organisms

    • Confirm in human cells for translational relevance

  • Data Reporting:

    • Follow ARRIVE guidelines for animal experiments

    • Report all experimental conditions in detail

    • Make raw data available through appropriate repositories

These practices will help ensure that findings related to CG3792 function and interactions are robust and reproducible across different research settings.

How can researchers validate the specificity of phenotypes observed in CG3792 knockout or knockdown experiments?

Multiple complementary approaches should be used to validate phenotype specificity:

  • Multiple Independent Knockdown/Knockout Methods:

    • Use different sgRNAs targeting distinct regions of CG3792

    • Compare CRISPR/Cas9 knockout with RNAi knockdown

    • Create precise mutations using homologous recombination

  • Rescue Experiments:

    • Re-express wild-type CG3792 in knockout backgrounds

    • Test structure-function relationships with mutant versions

    • Test cross-species rescue with human MPDU1

  • Dose-Response Relationships:

    • Use inducible or partial knockdown systems

    • Correlate phenotype severity with reduction level

    • Test hypomorphic and null alleles

  • Specificity Controls:

    • Test related genes from the same family

    • Knockout genes in parallel pathways

    • Use specific inhibitors when available

  • Independent Phenotypic Assays:

    • Measure phenotypes using multiple different methods

    • Assess cellular and organismal effects

    • Look for expected molecular signatures (e.g., changes in glycosylation)

This comprehensive validation approach was effectively used in CRISPR screens that identified genetic interactions with DPAGT1, where multiple sgRNAs per gene were used to mitigate sgRNA-specific effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.