Recombinant Drosophila melanogaster Metaxin-1 homolog (CG9393)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CG9393; Metaxin-1 homolog; Mitochondrial outer membrane import complex protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-327
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG9393
Target Protein Sequence
MEMQLGAMLYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQI GNQKFAGYRQIKRVLDLEGYPIDAHLSTKQKHLSTAYANWVFTNLHAYYHYFLFGEPHNF DTTTRGLYAKRTPFPFNFYYPSSYQREACDVVQVMAGFDVNDKLDKHEGDYLVVNAKKVV NLLSRKLGRKVWFFGDTYSEFDAIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRIT KDIFRIEGYSSVKLTKTPSGTEASLTASERKFLDSELNTKIVAGVGAVLAMGAFAAWRGI YNQLTTRSSTDYDGIDYEDDEMEEGLD
Uniprot No.

Target Background

Function
Metaxin-1 homolog (CG9393) is involved in mitochondrial protein transport and is crucial for embryonic development.
Database Links

KEGG: dme:Dmel_CG9393

STRING: 7227.FBpp0081591

UniGene: Dm.4515

Protein Families
Metaxin family
Subcellular Location
Mitochondrion outer membrane.

Q&A

Basic Research Questions

  • What is the function of Metaxin-1 homolog (CG9393) in Drosophila melanogaster?

    Based on studies of metaxins in other organisms, Drosophila Metaxin-1 appears to be a critical component of mitochondrial transport adaptor complexes. Similar to its orthologs in other species, Metaxin-1 likely contributes to proper mitochondrial trafficking in both dendrites and axons . Research suggests that metaxins connect mitochondria to molecular motors, enabling their transport along microtubules to locations where energy production is needed.

  • How does Metaxin-1 interact with mitochondrial transport machinery in Drosophila?

    Metaxin-1 likely functions in conjunction with the mitochondrial outer membrane protein Miro and adaptor proteins like TRAKs/Milton to form a complex that links mitochondria to molecular motors . Evidence from C. elegans indicates that MTX-1 can be co-immunoprecipitated by MTX-2 when co-expressed in cells, suggesting these proteins physically interact as part of the transport complex . This interaction network appears essential for proper mitochondrial distribution in neuronal processes.

  • What happens to mitochondrial distribution when Metaxin-1 is disrupted?

    Studies in C. elegans demonstrate that MTX-1 mutants show impaired mitochondrial trafficking specifically in regions containing plus-end-out microtubules, such as axons and posterior dendrites . Based on this evidence, disruption of Drosophila Metaxin-1 would likely result in reduced mitochondrial localization in axons and other cellular compartments with plus-end-out microtubule arrays, suggesting a specific role in kinesin-mediated transport rather than dynein-mediated transport.

  • How is Metaxin-1 expression regulated during Drosophila development?

    While the provided search results don't directly address developmental regulation of Metaxin-1, expression patterns of mitochondrial proteins often correlate with energy demands during development. Researchers interested in this question would need to perform developmental time course experiments using qRT-PCR, Western blotting, or fluorescent reporter constructs to track Metaxin-1 expression across embryonic, larval, pupal, and adult stages.

Advanced Experimental Design

  • What are the optimal systems for expressing recombinant Drosophila Metaxin-1?

    Recombinant Drosophila Metaxin-1 can be expressed in multiple systems, each with distinct advantages:

    Expression SystemAdvantagesLimitationsBest Applications
    E. coliHigh yield, low costLimited post-translational modificationsStructural studies, antibody production
    YeastEukaryotic processing, moderate yieldSome modifications may differ from insectsFunctional studies requiring basic modifications
    Baculovirus/insect cellsNative-like processing for Drosophila proteinsHigher cost, longer production timeFunctional studies, protein-protein interactions
    Mammalian cellsComplex eukaryotic modificationsHighest cost, potentially lower yieldStudies involving mammalian protein partners

    For studying Metaxin-1's basic biochemical properties, bacterial expression may be sufficient, while functional studies would benefit from expression in insect or mammalian cells .

  • How can I design experiments to investigate Metaxin-1's role in mitochondrial dynamics?

    A comprehensive experimental approach would include:

    • Generate fluorescently-tagged Metaxin-1 constructs (similar to GFP::MIRO-1 in search result ) to visualize localization

    • Perform CRISPR-Cas9 gene editing to create Metaxin-1 null mutants (as done for MTX-1 in C. elegans )

    • Conduct time-lapse imaging of mitochondrial movement in wild-type versus mutant backgrounds

    • Use co-immunoprecipitation and GST pull-down assays to identify binding partners (as demonstrated for MTX-1/MTX-2 interactions )

    • Perform rescue experiments with wild-type and domain-specific mutants to identify critical functional regions

    • Compare mitochondrial distribution in different neuronal compartments with distinct microtubule orientations

  • What controls should be included when studying Metaxin-1 protein-protein interactions?

    When investigating Metaxin-1 interactions, essential controls include:

    • Negative control proteins unlikely to interact with Metaxin-1 (such as DRP-1, which was shown not to co-precipitate with MTX-2 or MIRO-1 )

    • Reciprocal co-immunoprecipitation experiments (pull-down with Metaxin-1 antibody and check for partner, then pull-down with partner antibody and check for Metaxin-1)

    • Truncated versions of Metaxin-1 lacking specific domains to map interaction interfaces

    • Competition assays with purified proteins to confirm direct interactions

    • In vitro binding assays using bacterial expressed proteins (as done for MIRO-1 and MTX-2 ) to determine if interactions are direct

  • How can I distinguish between the roles of different metaxin family members in Drosophila?

    To differentiate the functions of metaxin family proteins:

    • Generate single and double mutants for different metaxin genes

    • Perform rescue experiments with each metaxin to test for functional redundancy

    • Compare subcellular localization patterns using fluorescently tagged proteins

    • Examine tissue-specific expression patterns to identify potential specialized functions

    • Investigate whether different metaxins associate with distinct microtubule-based motors (research in C. elegans suggests MTX-1 specifically functions with kinesin-mediated transport )

    • Use proximity labeling to identify unique protein interaction networks for each metaxin

Methodological Approaches

  • What techniques are most effective for visualizing Metaxin-1 localization in Drosophila tissues?

    Based on methods used in related research, effective visualization approaches include:

    • CRISPR-mediated endogenous tagging with fluorescent proteins or HaloTag (as done for MIRO-1 in C. elegans )

    • Immunofluorescence using specific antibodies against Metaxin-1

    • Co-staining with mitochondrial markers like TOMM-20 to confirm mitochondrial localization

    • Live imaging of fluorescently tagged Metaxin-1 in primary neuron cultures

    • Super-resolution microscopy for precise subcellular localization

    • Electron microscopy with immunogold labeling for ultrastructural localization

  • How can I quantitatively assess mitochondrial transport defects in Metaxin-1 mutants?

    Quantitative analysis should include:

    • Track individual mitochondria to measure velocity, run length, and pause frequency

    • Compare anterograde versus retrograde transport rates (particularly important as C. elegans MTX-1 specifically affects plus-end directed transport )

    • Measure mitochondrial density in different cellular compartments (soma, dendrites, axons)

    • Quantify the percentage of mobile versus stationary mitochondria

    • Analyze mitochondrial morphology (size, shape, interconnectivity) as secondary effects

    • Use kymograph analysis to visualize transport over time along neuronal processes

  • What are the best approaches for testing if Metaxin-1 interacts with the Miro-Milton complex?

    To investigate these interactions:

    • Perform co-immunoprecipitation experiments with tagged versions of Metaxin-1 and Miro/Milton proteins (as demonstrated for MTX-2 and MIRO-1 in search result )

    • Use GST pull-down assays with bacterial expressed proteins to test for direct binding

    • Conduct yeast two-hybrid or mammalian two-hybrid assays to confirm interactions in different systems

    • Perform proximity ligation assays in Drosophila tissues to visualize interactions in situ

    • Use FRET or BiFC to detect interactions in living cells

    • Test genetic interactions through double mutant analysis and rescue experiments

  • How should I design experiments to determine if Metaxin-1 has microtubule orientation-specific functions?

    Based on findings in C. elegans where MTX-1 specifically functions in plus-end directed transport :

    • Compare mitochondrial distribution in neuronal compartments with known microtubule orientations (axons versus dendrites)

    • Use markers to visualize microtubule polarity alongside mitochondrial distribution

    • Examine mitochondrial transport in neurons with altered microtubule polarity

    • Test for genetic interactions between Metaxin-1 and kinesin versus dynein motor proteins

    • Perform in vitro reconstitution assays with purified components on oriented microtubules

    • Compare results with those from MTX-1 mutants in C. elegans, which showed defects specifically in plus-end-out microtubule arrays

Data Analysis and Interpretation

  • How should I analyze conflicting results regarding Metaxin-1 function in different tissues?

    When facing contradictory findings:

    • Consider tissue-specific differences in microtubule organization, as research shows MTX-1 function depends on microtubule polarity

    • Investigate potential redundancy with other metaxin family members in different tissues

    • Examine expression levels across tissues, as dosage effects might explain functional differences

    • Look for tissue-specific binding partners that might modify Metaxin-1 activity

    • Consider developmental timing of experiments, as protein function might vary across stages

    • Use tissue-specific rescue experiments to confirm context-dependent functions

  • What statistical approaches are most appropriate for analyzing mitochondrial movement defects?

    Robust statistical analysis should include:

    • Paired t-tests or ANOVA to compare mitochondrial density between genotypes

    • Non-parametric tests (Mann-Whitney, Kruskal-Wallis) for velocity data that often shows non-normal distribution

    • Mixed-effects models for time-course experiments with multiple measurements per cell

    • Multiple regression analysis to examine relationships between movement parameters

    • Bootstrap or permutation tests for complex datasets

    • Power analysis to determine appropriate sample sizes based on expected effect magnitudes

  • How can I distinguish direct from indirect effects of Metaxin-1 on mitochondrial function?

    To differentiate primary and secondary effects:

    • Use acute protein depletion systems to observe immediate versus long-term consequences

    • Perform in vitro reconstitution with purified components to test direct effects

    • Conduct time-course experiments following Metaxin-1 disruption to establish sequence of events

    • Use epistasis analysis with other transport components to position Metaxin-1 in the pathway

    • Compare phenotypes of partial versus complete loss-of-function alleles

    • Employ domain-specific mutants to identify regions responsible for different functions

  • How do I interpret differences in Metaxin-1 function between Drosophila and other model organisms?

    When analyzing cross-species differences:

    • Perform phylogenetic analysis to determine evolutionary relationships between metaxin proteins

    • Compare protein domain structures across species to identify conserved and divergent regions

    • Consider differences in cellular architecture (e.g., neuron morphology, microtubule organization)

    • Conduct cross-species rescue experiments (e.g., express Drosophila Metaxin-1 in C. elegans MTX-1 mutants)

    • Compare binding partners across species to identify conserved interaction networks

    • Consider that C. elegans MTX-1 shows polarity-specific function in mitochondrial transport , which may be conserved in Drosophila

Technical Considerations

  • What purification strategy yields the highest activity for recombinant Drosophila Metaxin-1?

    Optimal purification approaches include:

    • Affinity chromatography using tags such as His, GST, or MBP

    • Detergent screening to identify conditions that maintain protein stability

    • Size exclusion chromatography as a final purification step to ensure homogeneity

    • Co-expression with known binding partners to improve stability

    • Buffer optimization to preserve native conformation

    • Testing both bacterial and eukaryotic expression systems to compare yields and activity

  • How can I optimize CRISPR-Cas9 gene editing to create precise Metaxin-1 mutants?

    Effective CRISPR-Cas9 strategies include:

    • Design multiple guide RNAs targeting different regions of the Metaxin-1 gene

    • Include repair templates for precise introduction of mutations or tags

    • Use Cas9 nickase approaches to reduce off-target effects

    • Screen multiple independent lines to control for off-target mutations

    • Validate mutations by sequencing and expression analysis

    • Confirm phenotypes with complementation tests and rescue experiments

  • What factors might affect the reproducibility of Metaxin-1 functional assays?

    Key reproducibility considerations include:

    • Genetic background effects in Drosophila strains

    • Environmental conditions during development and aging

    • Experimental timing (developmental stage, circadian effects)

    • Expression levels of tagged proteins (overexpression artifacts)

    • Detection methods sensitivity and specificity

    • Cell/tissue type variation in mitochondrial transport requirements

    • Temperature effects on mitochondrial dynamics and protein function

  • How can I develop an effective antibody against Drosophila Metaxin-1?

    Strategic approaches include:

    • Express and purify recombinant Metaxin-1 or unique peptides for immunization

    • Select antigenic regions with low similarity to other Drosophila proteins

    • Validate antibody specificity using Metaxin-1 null mutants as negative controls

    • Test antibody performance in multiple applications (Western blot, immunoprecipitation, immunofluorescence)

    • Consider developing monoclonal antibodies for highest specificity

    • Validate subcellular localization patterns through co-staining with mitochondrial markers like TOMM-20

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.