Recombinant Drosophila melanogaster Mitochondrial import inner membrane translocase subunit TIM50-B (ttm2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ttm2; CG12313; Mitochondrial import inner membrane translocase subunit TIM50-B; Tiny tim 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
43-409
Protein Length
Full Length of Mature Protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
ttm2
Target Protein Sequence
GDVGKPGMELGRCSCFGLRVNLSNASVVYVGHRRYSTYEKTSTQILTKLFPQTSEESNDE ESRERRKLEEEEEQKELERAFRRMKLGFGLFGIGSMLFSFWAIYFYGRPSLDEHGNEVID EFSCLPQMQQLMWRTWKSVNRFQRFFKEPSRKKLLPDPLQPPYVQPPYTLVLEIKDVLVH PDWTYETGWRFKKRPGVDVFLKECAKYFEIVVYTAEQGVTVFPLVDALDPNGCIMYRLVR DSTHFDGGHHVKNLDNLNRDLKRVVVVDWDRNSTKFHPSNSFSIPRWSGNDNDTTLFELT SFLSVLGTSEIDDVREVLQYYNQFSDSLSQFRENQRKLGELMHAEEVEKTSKSRPVVKNW TRGFINH
Uniprot No.

Target Background

Function
Essential component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links

KEGG: dme:Dmel_CG12313

STRING: 7227.FBpp0072407

UniGene: Dm.5120

Protein Families
TIM50 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Tissue Specificity
Exclusively expressed in the testis.

Q&A

What is the function of TIM50-B in Drosophila melanogaster mitochondria?

TIM50-B (ttm2) functions as a key component of the mitochondrial import machinery, specifically within the Translocase of the Inner Membrane (TIM) complex. Similar to the extensively studied TOM complex (Translocase of the Outer Membrane), TIM50-B plays a crucial role in recognizing and facilitating the transfer of nuclear-encoded mitochondrial proteins across the inner mitochondrial membrane. While TOM serves as the initial entry point for mitochondrial precursor proteins, TIM50-B is involved in the subsequent steps of protein import into the mitochondrial matrix or inner membrane integration .

How does TIM50-B relate to other mitochondrial import proteins?

TIM50-B functions as part of the larger mitochondrial protein import system that includes both the TOM and TIM complexes. Most mitochondrial precursor proteins are encoded in the cell nucleus and synthesized on cytoplasmic ribosomes, requiring these specialized import machinery components for proper targeting and translocation. TIM50-B specifically acts downstream of the TOM complex, which serves as the main protein-import pore of the outer mitochondrial membrane, recognizing nascent precursors of mitochondrially targeted proteins and transferring them across the outer membrane .

What structural features are characteristic of TIM50-B?

While specific structural data for Drosophila TIM50-B is limited in the provided search results, insights can be drawn from related mitochondrial import proteins. Similar to components of the TOM complex that form β-barrel structures (e.g., Tom40), TIM50-B likely contains specific domains for protein-protein interactions and precursor recognition. The protein may contain transmembrane regions anchoring it to the inner mitochondrial membrane, with exposed domains that interact with incoming precursor proteins from the TOM complex .

What are effective strategies for expressing recombinant TIM50-B in Drosophila systems?

Based on successful approaches with similar mitochondrial import proteins, an effective strategy is to employ the bipartite UAS-GAL4 expression system in Drosophila. This allows for tissue-specific expression of the TIM50-B transgene fused to epitope tags (such as FLAG-HA) for purification purposes. For optimal expression, consider using the GMR promotor to target protein expression to the photoreceptor cells of the fly retina, which provides rich membrane content. Additionally, co-expression with Myc can significantly enhance protein yield by increasing cellular mitochondrial content .

How can protein yield be optimized when expressing TIM50-B in Drosophila?

To optimize TIM50-B yield, consider the following approach that proved successful with Tom40:

  • Co-express the oncogenic transcription factor Myc under the GMR promotor, which leads to higher cellular mitochondrial content

  • This strategy can increase transgenic protein expression significantly and may enhance expression of other endogenous mitochondrial proteins

  • Additionally, Myc expression may help suppress apoptosis of photoreceptor cells driven by expression of mitochondrial protein transgenes, resulting in an increase in viable eye tissue

  • Combined, these approaches can substantially enhance the yield of mitochondrial proteins for structural studies

What purification methods are recommended for isolating recombinant TIM50-B from Drosophila tissues?

For effective purification of TIM50-B from Drosophila tissues, a recommended protocol would include:

  • Solubilization of fly head membranes using appropriate detergents (n-tetradecyl-β-d-maltopyranoside–cholesterol hemisuccinate combinations have proven more effective than digitonin for preserving complex integrity)

  • Extraction of the protein complex from solubilized lysates using epitope tag-based affinity chromatography (e.g., FLAG-based)

  • Implementation of a single-step on-column protocol to minimize protein loss during purification

  • Sequential washing of bound complex with buffer solutions containing 0.5 M NaCl and 1 M urea

  • Verification of purified components using tryptic digest mass spectrometry

  • On-column reconstitution into a non-ionic amphipol to resolve excess detergent issues during final protein-concentration steps

How can structural analysis of TIM50-B be approached using cryo-electron microscopy?

For structural analysis of TIM50-B using cryo-electron microscopy (cryoEM), researchers should consider:

  • Optimization of protein sample preparation through careful detergent selection and reconstitution into non-ionic amphipols to minimize detergent accumulation

  • Initial negative-stain analysis to assess sample quality and homogeneity before proceeding to cryoEM

  • Generation of prediction models using AlphaFold-Multimer to aid in model building

  • Refinement of models using tools such as ISOLDE within UCSF ChimeraX and Coot

  • Additional real-space refinement in software like Phenix

  • Careful fitting of phospholipid components that may be critical at protein-protein interfaces

  • Comparative analysis with related structures to identify conserved features and potential functional elements

What lipid-protein interactions are important to consider when studying TIM50-B structure and function?

When studying TIM50-B, careful attention should be paid to lipid-protein interactions as they may significantly impact structure and function. For example, in the TOM complex, lipid binding at subunit interfaces influences conformational arrangements. Specific conserved residues in mitochondrial import proteins often form lipid-binding pockets, with aromatic residues (tryptophan, tyrosine) frequently stabilizing these interactions. The number and positioning of lipids at subunit interfaces can affect the angular separation between components. Disease-linked mutations in mitochondrial import proteins have been found to map to residues involved in both protein-protein and protein-lipid interactions, highlighting their functional importance .

How can comparative analysis between Drosophila TIM50-B and human orthologs inform research on disease mechanisms?

Comparative analysis between Drosophila TIM50-B and human orthologs can provide valuable insights into disease mechanisms through:

  • Identification of conserved residues that may be critical for function across species

  • Mapping of disease-associated mutations in human proteins to their corresponding positions in Drosophila orthologs

  • Leveraging Drosophila as a model system to study the effects of mutations in vivo

  • Correlation of structural data with phenotypic outcomes in Drosophila disease models

  • Investigation of how mutations affect protein complex assembly and stability

  • Exploration of tissue-specific effects of mutations, particularly in neuronal tissues where mitochondrial dysfunction often manifests

  • Utilization of Drosophila genetic screening experiments to identify genetic modifiers and potential therapeutic targets

What approaches are recommended for analyzing protein-protein interactions within the TIM complex?

For analyzing protein-protein interactions within the TIM complex containing TIM50-B, the following approaches are recommended:

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE) analysis of detergent-solubilized membranes to assess complex formation and stability

  • Mass spectrometry verification of co-purifying components following affinity purification

  • Comparative structural analysis with related complexes to identify conserved interaction interfaces

  • Mutation analysis targeting predicted interface residues to assess their contribution to complex stability

  • Cross-linking mass spectrometry to identify proximity relationships between subunits

  • Computational prediction of protein-protein interaction interfaces using tools like AlphaFold-Multimer

  • In vivo validation of key interactions through genetic approaches in Drosophila

How should researchers interpret structural differences between Drosophila TIM50-B and orthologs from other species?

When interpreting structural differences between Drosophila TIM50-B and orthologs from other species, researchers should consider:

  • Subtle conformational changes at subunit interfaces may be attributable to variation in lipid-binding residues

  • While the quaternary fold of mitochondrial import complexes is often conserved across species, local nuances of structural elements implicated in precursor import may indicate subtle evolutionary changes

  • Differences in loop regions and non-conserved domains may reflect species-specific functional adaptations

  • The positioning of conserved aromatic and charged residues at protein-protein interfaces can provide insight into functional conservation

  • Root-mean-square deviation (r.m.s.d.) calculations between aligned structures can quantify the degree of structural conservation

  • Differential lipid binding at subunit interfaces may account for conformational variations between orthologs

  • Species-specific post-translational modifications may influence protein structure and function

What considerations are important when designing mutagenesis experiments for TIM50-B functional studies?

When designing mutagenesis experiments for TIM50-B functional studies, researchers should consider:

Mutation TypeSelection CriteriaExpected OutcomesAnalysis Methods
Conserved Interface ResiduesHigh conservation across species, located at protein-protein interfacesAltered complex assembly or stabilityBN-PAGE, affinity purification
Lipid-Binding ResiduesAromatic or charged residues at membrane interfacesChanged lipid interactions, altered conformationLipidomics, structural analysis
Disease-Associated VariantsResidues corresponding to human disease mutationsPhenotypic effects, altered protein functionIn vivo Drosophila models, behavioral assays
Catalytic ResiduesConserved charged or polar residues in functional domainsImpaired protein import without affecting structureImport assays, respiration measurements
Transmembrane AnchorsHydrophobic regions predicted to span the membraneMislocalization, impaired membrane integrationSubcellular fractionation, microscopy

The choice of mutation sites should be informed by both sequence conservation analysis and structural data when available. Integration of in vitro biochemical assays with in vivo functional studies in Drosophila can provide comprehensive insights into the functional importance of specific residues .

What are common challenges in obtaining sufficient yields of functional TIM50-B protein?

Common challenges in obtaining sufficient yields of functional TIM50-B protein include:

  • Potential toxicity from overexpression, which may cause retinal neurodegeneration in Drosophila expression systems

  • Instability of membrane protein complexes during solubilization and purification

  • Detergent-induced dissociation of multiprotein complexes

  • Accumulation of excess detergent during final protein-concentration steps

  • Heterogeneity in complex assembly and oligomeric state

  • Limited viable tissue due to transgene-induced toxicity

  • Challenges in maintaining native lipid environments important for protein function

To address these challenges, researchers can implement strategies such as co-expression with Myc to increase mitochondrial content and suppress apoptosis, careful selection of detergents, on-column reconstitution into non-ionic amphipols, and optimization of expression systems using tissue-specific promoters .

How can researchers distinguish between functional and non-functional forms of purified TIM50-B?

To distinguish between functional and non-functional forms of purified TIM50-B, researchers can employ multiple complementary approaches:

  • Structural integrity assessment using negative-stain electron microscopy and cryoEM

  • Blue native gel electrophoresis to verify proper complex assembly

  • Verification of co-purifying partner proteins through mass spectrometry

  • Functional reconstitution assays to test protein import capability

  • Analysis of lipid composition associated with purified protein complexes

  • Thermal stability assays to assess protein folding and stability

  • Comparative analysis with wild-type protein from native sources

  • In vitro protein import assays using isolated mitochondria

  • Assessment of interaction with known partner proteins or substrates

What emerging technologies might advance our understanding of TIM50-B function?

Emerging technologies that could advance our understanding of TIM50-B function include:

  • CryoEM methodologies for higher-resolution structural determination of membrane protein complexes

  • Integration of AlphaFold-Multimer and similar AI tools for predicting complex structures

  • Advanced genetic tools in Drosophila for tissue-specific and temporally controlled expression

  • Live-cell imaging approaches to visualize protein import dynamics

  • Proximity labeling techniques to identify transient protein interactions

  • Single-molecule techniques to study conformational changes during protein import

  • Integration of structure, imaging, genetics, and omics data from the same source

  • Development of Drosophila disease models for studying human disease-associated variants

  • Advanced lipidomics to characterize protein-lipid interactions in native environments

How might the study of TIM50-B in Drosophila contribute to understanding human mitochondrial diseases?

The study of TIM50-B in Drosophila can contribute significantly to understanding human mitochondrial diseases through:

  • Providing a genetically tractable model system to study conserved aspects of mitochondrial protein import

  • Enabling correlation of structure to physiological function in vivo

  • Allowing tissue-specific expression studies to investigate cell-type-specific effects of mutations

  • Supporting genetic screening experiments to identify modifiers of disease phenotypes

  • Offering insights into how alterations in mitochondrial import proteins may contribute to neurodegeneration

  • Providing an experimental platform to test hypotheses about disease mechanisms

  • Allowing for the study of how mutations in mitochondrial import machinery affect various aspects of mitochondrial function

  • Facilitating the identification of potential therapeutic targets through genetic interaction studies

  • Enabling the study of how mitochondrial import defects contribute to age-related diseases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.