Recombinant Drosophila melanogaster Mitoferrin (mfrn)

Shipped with Ice Packs
In Stock

Description

Introduction to Mitoferrin in Drosophila melanogaster

Drosophila melanogaster Mitoferrin (dmfrn) is a mitochondrial carrier protein with an established role in the mitochondrial iron metabolism. Unlike vertebrates, which possess two mitoferrin paralogs (mitoferrin1 and mitoferrin2), Drosophila and other invertebrates have only one mitoferrin gene, which functions as a homolog of vertebrate mitoferrin2 . The protein primarily facilitates the transport of iron across the mitochondrial membrane, playing a crucial role in cellular iron homeostasis through the iron-sulfur cluster synthesis pathway .

The study of mitoferrin function has been significantly advanced through the development of recombinant forms of the protein. Recombinant Drosophila melanogaster Mitoferrin refers to the artificially produced version of the native dmfrn protein, typically generated through molecular cloning techniques to express the protein in cellular systems for research purposes. These recombinant versions often include tags or fusion partners that facilitate detection, purification, or visualization of the protein while maintaining its natural function .

One of the most significant applications of recombinant dmfrn has been in elucidating its role in spermatogenesis. Research has shown that dmfrn is essential for male fertility in Drosophila, with mutations in the gene leading to sterility. The development of fluorescently tagged transgenic dmfrn genomic constructs (dmfrn-venus) has allowed researchers to track the protein's expression and localization during spermatid development, revealing its accumulation in mitochondrial derivatives and subsequent disposal during the individualization process .

Genetic Structure and Expression of dmfrn

The Drosophila melanogaster mitoferrin gene (dmfrn) is expressed ubiquitously throughout the organism, with notably higher expression in testes compared to other tissues. Contrary to initial expectations based on FlyAtlas data, RT-PCR analysis revealed that dmfrn expression is approximately two-fold higher in testes compared to whole fly homogenates . This expression pattern aligns with the significant role of mitochondrial iron metabolism in spermatogenesis.

In testes, dmfrn expression is most pronounced in spermatids, coinciding with stages that show defects in dmfrn mutants. Visualization of dmfrn-venus protein under fluorescence microscopy confirmed this expression pattern, with clear signals visible in elongated spermatids . Confocal microscopy with increased gain additionally detected dmfrn-venus protein in spermatocytes and the testis sheath, though at lower levels than in spermatids .

During spermatid development, dmfrn-venus accumulates in nebenkerns of onion stage spermatids and in elongated spermatids. During individualization, the protein accumulates in mitochondrial whorls in front of the actin cones of individualization complexes, with the bulk eventually accumulating in cystic bulges and waste bags . This dynamic localization pattern suggests a critical role for dmfrn during specific stages of sperm development.

Production Methods for Recombinant dmfrn

The production of recombinant Drosophila melanogaster Mitoferrin involves sophisticated molecular biology techniques that allow for controlled expression and functional analysis of the protein. While specific detailed protocols for dmfrn production are not exhaustively described in the available research, several approaches have been successfully implemented.

The most well-documented approach involves the creation of transgenic Drosophila lines expressing tagged versions of the dmfrn protein. Researchers have generated a fluorescently tagged transgenic dmfrn genomic construct (dmfrn-venus) that successfully rescues the phenotype of dmfrn mutants . This indicates that functional recombinant dmfrn can be effectively produced in vivo within the Drosophila system itself.

The production process typically involves:

Production StageKey TechniquesOutcome
Gene CloningPCR amplification, restriction enzyme digestion, ligationIsolation of dmfrn gene
Vector ConstructionInsertion into expression vectors with appropriate tagsCreation of expression constructs
TransformationP-element mediated transformation into DrosophilaGeneration of transgenic flies
VerificationPCR confirmation, sequencing, expression analysisConfirmation of successful recombinant production

For the dmfrn-venus construct specifically, the transgene was verified through PCR confirmation and demonstrated functionality through rescue experiments. Flies were kept on standard potato sucrose medium in a 12 h/12-h light/dark cycle, with stocks maintained at 18°C and experimental crosses carried out at room temperature (22-25°C) .

Functional Characterization of Recombinant dmfrn

Recombinant forms of Drosophila melanogaster Mitoferrin have been instrumental in elucidating the protein's functions in iron metabolism and spermatogenesis. Functional studies have revealed several key aspects of its biological role with significant implications for cellular physiology.

The primary function of dmfrn, as demonstrated through studies with recombinant proteins, is the transport of iron across the mitochondrial membrane, which is essential for processes including iron-sulfur cluster synthesis . It may act in the mitochondria to transport substrates necessary for the maturation of iron-cluster scaffold (ICS) proteins, which are involved in iron homeostasis . Dysregulation of dmfrn affects cellular iron homeostasis, highlighting its importance in maintaining proper iron levels within mitochondria .

One of the most significant findings facilitated by recombinant dmfrn studies is its essential role in male fertility. P-element insertions into the 5'-untranslated region of the dmfrn gene cause recessive male sterility, a phenotype that was successfully rescued by introducing a recombinant fluorescently tagged dmfrn genomic construct (dmfrn-venus) . This not only confirmed the specific role of dmfrn in male fertility but also demonstrated that the recombinant protein retained full functionality despite the addition of the venus tag.

Detailed examination of testes from dmfrn mutant flies revealed profound structural abnormalities. Testes were either small with unorganized content, contained some partially elongated spermatids, or were of normal size but lacked mature sperm . Testis squashes indicated defective spermatid elongation, and electron micrographs showed mitochondrial defects in elongated spermatids with failed individualization . These observations firmly establish the critical role of dmfrn in proper mitochondrial function during spermatogenesis.

Comparative Analysis with Vertebrate Mitoferrins

Recombinant dmfrn provides an excellent model for understanding the broader mitoferrin family of proteins across species. Comparative studies between Drosophila mitoferrin and its vertebrate counterparts have revealed both similarities and distinctions that enhance our understanding of these proteins' evolution and specialized functions.

The following table summarizes key differences between Drosophila mitoferrin and vertebrate mitoferrins:

CharacteristicDrosophila MitoferrinVertebrate Mitoferrin1Vertebrate Mitoferrin2
Number of genesSingle geneOne of two paralogsOne of two paralogs
Expression patternUbiquitous with higher expression in testesMainly in erythropoietic tissuesUbiquitous
Primary functionIron transport in mitochondria; essential for spermatogenesisCritical for hemoglobinizationGeneral mitochondrial iron homeostasis
Rescue capabilityN/ACan rescue yeast MRS3/4 double mutants and zebrafish frascati mutantsCan rescue yeast MRS3/4 double mutants but not zebrafish frascati mutants
Protein accumulationIncreased in spermatidsAccumulates in erythropoietic cellsDoes not accumulate in erythropoietic cells

Despite these differences, the fundamental role in mitochondrial iron transport appears to be conserved across species. This evolutionary conservation underscores the essential nature of mitoferrin function in cellular metabolism and suggests that findings from studies using recombinant dmfrn may have broader implications for understanding mitochondrial iron transport in higher organisms.

Role of Recombinant dmfrn in Disease Modeling

Research utilizing recombinant Drosophila melanogaster Mitoferrin has contributed significantly to our understanding of disease mechanisms, particularly those involving mitochondrial dysfunction and iron metabolism disorders. The Drosophila model system, combined with recombinant dmfrn tools, has proven valuable for investigating pathological processes and potential therapeutic approaches.

A notable example comes from studies of Friedreich's ataxia, the most common recessive ataxia in the Caucasian population. This disorder results from loss of frataxin expression, which affects the production of iron-sulfur clusters and leads to mitochondrial energy production deficits . In frataxin-deficient flies, there is an increase of iron transport into the mitochondrial compartment, leading to toxic accumulation of reactive iron .

Remarkably, research has demonstrated that mitoferrin downregulation improved many frataxin-deficient conditions, including nervous system degeneration, whereas mitoferrin overexpression exacerbated these conditions . This finding suggests that impairment of mitochondrial iron transport could potentially serve as an effective treatment approach for the disease.

The mechanism behind this therapeutic effect involves preventing the inappropriate accumulation of reactive iron in mitochondria. Two key molecular events appear to drive the iron-induced phenotype in frataxin-deficient flies: the inability to activate ferritin translation and the enhancement of mitochondrial iron uptake via mitoferrin upregulation . By reducing mitoferrin levels, the enhanced mitochondrial iron uptake associated with frataxin deficiency can be counteracted, thereby mitigating the toxic effects of iron overload.

These findings highlight how recombinant dmfrn and genetic manipulation of mitoferrin expression in Drosophila can serve as valuable tools for modeling human diseases and exploring potential therapeutic strategies. The conservation of iron metabolism pathways between flies and humans makes these models particularly relevant for translational research.

Applications in Developmental Biology Research

Recombinant Drosophila melanogaster Mitoferrin has proven to be an invaluable tool in developmental biology research, particularly in studies of spermatogenesis and mitochondrial function during development. The ability to visualize and manipulate mitoferrin expression has provided unique insights into developmental processes that depend on proper iron metabolism.

The dmfrn-venus fusion protein has been particularly useful for tracking the expression and localization of mitoferrin during spermatogenesis. Fluorescence microscopy studies have revealed that dmfrn-venus protein accumulates in elongated spermatids and the region of spermatid individualization . Confocal microscopy with increased gain has further shown that dmfrn-venus protein abundance increases in nebenkerns of onion stage spermatids and in elongated spermatids .

During spermatid individualization, dmfrn-venus accumulates in mitochondrial whorls in front of the actin cones of individualization complexes . At the end of spermatid individualization, the bulk of dmfrn-venus accumulates in cystic bulges and ultimately in waste bags . This detailed visualization of protein dynamics during development would not be possible without the recombinant fluorescently tagged protein.

The ability to generate specific mutants and perform rescue experiments represents another important application in developmental biology. Various P-element insertions into the 5'-untranslated region of the dmfrn gene have been characterized, including the SH115, BG00456, and EY01302 alleles . These mutations create an allelic series with varying severity, allowing researchers to study the consequences of different levels of dmfrn dysfunction on development.

Rescue experiments with recombinant dmfrn-venus have confirmed the specificity of developmental defects observed in mutants. The ability of the transgene to rescue male sterility in dmfrn mutant flies demonstrates both the specific requirement for dmfrn in spermatogenesis and the functional equivalence of the recombinant protein to its native counterpart .

Dietary Iron Effects on Recombinant dmfrn Function

An intriguing aspect of recombinant Drosophila melanogaster Mitoferrin research involves the interplay between dietary iron levels and protein function. Studies manipulating iron availability have revealed important insights into how environmental factors interact with mitoferrin function to influence developmental outcomes.

Research has shown that male sterility in flies with hypomorphic dmfrn alleles is significantly affected by dietary iron levels. Specifically, male sterility in flies with the hypomorph alleles dmfrn-venus and BG00456 dmfrn over the deletion Df(3R)ED6277 was increased by dietary iron chelation and suppressed by iron supplementation of the food . This finding demonstrates a direct relationship between environmental iron availability and the phenotypic consequences of reduced mitoferrin function.

Interestingly, male sterility in flies with complete loss of dmfrn function was not affected by food iron levels . This observation suggests that while partial mitoferrin function can be compensated for by increased iron availability, complete loss of the protein creates a defect that cannot be overcome simply by increasing substrate concentration.

These findings highlight the importance of considering nutrient availability when interpreting the phenotypic consequences of mutations in metabolic transport proteins. They also suggest potential approaches for modulating mitoferrin-related phenotypes through dietary interventions, which could have implications for the treatment of related disorders in humans.

The ability to study these interactions in vivo using recombinant dmfrn variants with different functional capacities provides a powerful system for understanding how genetic and environmental factors interact to influence development and fertility. This research exemplifies the value of Drosophila as a model organism for studying gene-environment interactions in the context of iron metabolism.

Future Research Directions and Potential Applications

The development and utilization of recombinant Drosophila melanogaster Mitoferrin have opened numerous avenues for future research in mitochondrial biology, iron metabolism, and disease modeling. Several promising directions for further investigation emerge from the current state of knowledge.

One priority area should be the comprehensive structural characterization of recombinant dmfrn. Detailed structural studies, potentially including X-ray crystallography or cryo-electron microscopy, would provide valuable insights into the protein's transport mechanism and inform structure-based drug design targeting mitoferrin functions. Such structural information would also facilitate comparative analyses with vertebrate mitoferrins, potentially revealing the molecular basis for functional specialization.

The systematic identification of dmfrn interaction partners represents another important research direction. Proteomic approaches using tagged recombinant dmfrn could reveal the composition of protein complexes involved in mitochondrial iron transport and metabolism. Understanding these interaction networks would enhance our knowledge of how dmfrn function is regulated and integrated with other cellular processes.

Given the finding that mitoferrin downregulation can ameliorate frataxin-deficient conditions in models of Friedreich's ataxia , the development of small-molecule modulators of dmfrn activity represents a promising therapeutic direction. High-throughput screening approaches using recombinant dmfrn could facilitate the identification of compounds that selectively inhibit dmfrn-mediated iron transport, potentially leading to novel treatments for disorders involving mitochondrial iron overload.

Further exploration of the relationship between dmfrn and other mitochondrial proteins is also warranted. For instance, investigating potential functional interactions between dmfrn and drim2, another Drosophila mitochondrial carrier involved in nucleotide transport , could reveal important insights into the coordination of different mitochondrial functions. Both proteins are essential for larval development, suggesting they may participate in related or interdependent processes.

Finally, expanding the application of recombinant dmfrn in disease modeling beyond Friedreich's ataxia could prove valuable. Drosophila models for other disorders involving iron metabolism dysregulation, such as hemochromatosis or certain neurodegenerative diseases, could benefit from the tools and approaches developed for studying dmfrn function.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand you may have specific requirements. Please indicate any format preferences during order placement, and we will fulfill them to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are routinely shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mfrn; CG4963; Mitoferrin; dmfrn
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
mfrn
Target Protein Sequence
MNIDDYESLPTTSVGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLRT MITREGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKELTAKFTSVRNLNYVISGAVATLI HDAISSPTDVIKQRMQMYNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHF TTYEFFQNKMNLERKYNPPVHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRGMIEA SRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFKFYLCGLDADQYKSSITGSSEP RKADYVLPRTTDEEQIDQEREAAKEKDTTATLHSAPTSVNASGAIKTVCELSTRPAGPTI NLHTRHTDVKSPYERGFST
Uniprot No.

Target Background

Function
Mitoferrin is a mitochondrial iron transporter that facilitates iron uptake. It is likely essential for heme synthesis in hemoproteins and Fe-S cluster assembly.
Gene References Into Functions
  1. Research has shown that mutations in the mitoferrin gene lead to male sterility due to developmental defects. The sensitivity of hypomorph mutants to low food iron levels suggests that mitochondrial iron plays a critical role in spermatogenesis. PMID: 20565922
  2. Overexpression of Mitoferrin has been shown to upregulate Fer1HCH transcription. PMID: 19453295
Database Links

KEGG: dme:Dmel_CG4963

STRING: 7227.FBpp0084635

UniGene: Dm.4065

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Drosophila melanogaster Mitoferrin (dmfrn) and what is its primary function?

Drosophila melanogaster Mitoferrin (dmfrn) is a mitochondrial carrier protein with an established role in mitochondrial iron metabolism. It represents the sole Drosophila homolog of yeast Mrs3/4 and vertebrate mitoferrin2. Studies of dmfrn in insect cell culture have demonstrated that its dysregulation affects cellular iron homeostasis through the iron-sulfur cluster synthesis pathway . Unlike vertebrates, which have two mitoferrin paralogs (mitoferrin1 and mitoferrin2), Drosophila and other invertebrates possess only one mitoferrin gene that functions similarly to vertebrate mitoferrin2 . The protein facilitates iron transport into mitochondria, which is essential for various cellular processes, particularly spermatogenesis.

How is dmfrn expressed across different tissues in Drosophila?

Dmfrn is ubiquitously expressed throughout Drosophila tissues, though with varying intensities. Contrary to initial reports in FlyAtlas suggesting lowest expression in testes, RT-PCR analysis has revealed that dmfrn transcript levels are approximately two-fold higher in testes compared to whole fly homogenates . In other tissues such as heads, thoraxes, guts, and malpighian tubules, dmfrn expression remains relatively consistent with whole-fly levels. Within testes specifically, dmfrn expression is highest in spermatids, with some expression also detectable in spermatocytes and the testis sheath . This expression pattern aligns with developmental stages affected in dmfrn mutants.

What phenotypes are associated with dmfrn mutations?

P-element insertions in the 5'-untranslated region of the dmfrn gene result in recessive male sterility . The phenotypes observed in mutant flies include:

Mutation TypeObserved Phenotypes
Homozygous dmfrn mutants- Small testes with unorganized content
- Partially elongated spermatids
- Normal-sized testes lacking mature sperm
- Defective spermatid elongation
- Mitochondrial abnormalities in elongated spermatids
- Failed individualization
Hypomorphic alleles- Male sterility increased by dietary iron chelation
- Male sterility suppressed by iron supplementation

Microscopic examination reveals that spermatid development is particularly affected, with defects in mitochondrial derivatives and individualization complexes .

What experimental systems are available for studying dmfrn function?

Several experimental tools have been developed for investigating dmfrn function:

  • P-element insertion lines: P{lacW}dmfrn^SH115, P{GT1}mfrn^BG00456, and P{EPgy2}mfrn^EY01302^ with insertions at different positions in the 5' UTR of dmfrn .

  • Deficiency line: Df(3R)ED6277, where dmfrn and a small part of the proximal region are deleted .

  • Reporter lines: The P{lacW}dmfrn^SH115^ line contains a β-galactosidase (lacZ) coding sequence that allows visualization of dmfrn expression patterns through X-gal staining .

  • Fluorescent protein tagging: Transgenic dmfrn-venus constructs permit live tracking of protein localization in cells and tissues .

These tools enable researchers to study dmfrn expression patterns, subcellular localization, and the consequences of its disruption.

How does dmfrn contribute to spermatogenesis, and what experimental approaches best reveal this function?

Dmfrn plays a critical role in spermatogenesis, specifically during spermatid elongation and individualization. Several experimental approaches can elucidate this function:

  • Fluorescent protein tagging and confocal microscopy: Using dmfrn-venus fusion proteins has revealed that dmfrn accumulates in the nebenkerns of onion-stage spermatids and in elongated spermatids . During individualization, dmfrn-venus protein concentrates in mitochondrial whorls ahead of actin cones in individualization complexes, eventually accumulating in cystic bulges and waste bags .

  • Electron microscopy: This approach reveals ultrastructural defects in mitochondrial derivatives of elongated spermatids in dmfrn mutants and indicates failed individualization .

  • Iron supplementation/chelation experiments: Manipulating dietary iron levels affects the severity of male sterility in hypomorphic dmfrn mutants, with iron supplementation suppressing sterility and iron chelation exacerbating it . Design these experiments by adding ferric ammonium citrate (iron supplementation) or bathophenanthroline disulfonate (iron chelation) to standard fly food at appropriate concentrations.

  • Stage-specific expression analysis: X-gal staining of testes from flies containing the P{lacW}dmfrn^SH115^ reporter construct reveals stage-specific expression patterns, showing dmfrn expression predominantly in spermatids .

To design conclusive experiments, combine genetic approaches (using various allele strengths) with dietary iron manipulations and high-resolution imaging of mitochondrial morphology during spermatogenesis.

What strategies can be employed to generate functional recombinant dmfrn for biochemical studies?

Producing functional recombinant dmfrn presents challenges common to mitochondrial membrane proteins. Consider these approaches:

  • Bacterial expression systems: Use E. coli strains optimized for membrane protein expression (e.g., C41(DE3) or C43(DE3)). Construct a vector with a cleavable N-terminal tag (His, GST, or MBP) after removing the mitochondrial targeting sequence to improve solubility.

  • Insect cell expression: Baculovirus expression systems using Sf9 or Hi5 cells often yield better results for Drosophila membrane proteins with proper folding.

  • Codon optimization: Adjust codon usage to match the expression system while preserving critical functional regions identified in the published dmfrn sequence .

  • Detergent screening: Test multiple detergents (DDM, LDAO, Fos-choline) for optimal extraction while maintaining protein activity.

  • Functionality verification: Develop iron transport assays using liposomes or reconstituted proteoliposomes to verify that the recombinant protein retains transport activity.

  • Limited proteolysis: Use to identify stable protein domains that might be more amenable to expression and crystallization if structural studies are planned.

The activity of recombinant dmfrn can be verified through complementation assays in yeast Mrs3/4 mutants, as both Drosophila and vertebrate mitoferrins can rescue these yeast mutants .

How can the subcellular localization of dmfrn be verified beyond fluorescent tagging?

While fluorescent tagging provides valuable information about dmfrn localization, additional methods strengthen these findings:

  • Subcellular fractionation: Isolate mitochondria through differential centrifugation and verify dmfrn enrichment in mitochondrial fractions by Western blot .

  • Proteinase K protection assays: Treat isolated mitochondria with proteinase K with and without membrane permeabilization to determine the submitochondrial localization of dmfrn. Protected fragments indicate localization within the mitochondrial membrane .

  • Immunogold electron microscopy: Using antibodies against dmfrn followed by gold-conjugated secondary antibodies allows precise localization at the ultrastructural level.

  • Proximity labeling approaches: BioID or APEX2 fused to dmfrn can identify neighboring proteins, confirming mitochondrial localization through known mitochondrial interaction partners.

  • Import assays: In vitro translation of dmfrn followed by incubation with isolated mitochondria can demonstrate mitochondrial import capability.

A comprehensive approach would combine several of these methods, as was done in studies showing dmfrn localization to mitochondria through both dmfrn-venus visualization and subcellular fractionation techniques .

What is the relationship between mitochondrial iron metabolism and mtDNA maintenance as revealed by studies of dmfrn and related proteins?

Recent research has begun to reveal connections between mitochondrial iron metabolism and mtDNA integrity:

  • Iron-sulfur cluster biogenesis: Iron transported by dmfrn contributes to iron-sulfur cluster synthesis, and these clusters are essential cofactors for multiple proteins involved in DNA replication and repair.

  • mtDNA recombination machinery: Studies have identified proteins like REC (an MCM helicase) that function in mtDNA recombination and double-strand break (DSB) repair . While not directly linked to dmfrn in current literature, both participate in essential mitochondrial processes.

  • Age-associated mtDNA integrity: REC has been shown to prevent age-associated mtDNA mutations . Iron metabolism disruptions through dmfrn mutation might similarly impact mtDNA stability over time.

  • Evolutionary conservation: Both dmfrn and mtDNA repair proteins show conservation between Drosophila and mammals, suggesting fundamental roles in mitochondrial biology .

Future research should investigate potential connections between iron metabolism proteins like dmfrn and mtDNA maintenance machinery, possibly through oxidative stress pathways or iron-dependent DNA repair mechanisms.

How do different dmfrn mutant alleles compare in their effects on spermatogenesis and iron metabolism?

Different dmfrn mutant alleles show varied phenotypic severity based on their location and nature:

AlleleLocationPhenotypic SeverityNotes
P{lacW}dmfrn^SH115^252 bp downstream of transcription startStrongest phenotypeOriginally recovered as recessive lethal
P{GT1}mfrn^BG00456^~40 bp downstream of transcription startIntermediateMale sterility but milder than SH115
P{EPgy2}mfrn^EY01302^~20 bp downstream of transcription startIntermediateContains UAS sequence for overexpression
Df(3R)ED6277Deletion of dmfrn and proximal regionMost severe when paired with other allelesSmall testes with no elongated spermatids in EY01302/Df combination

Experimental approaches to compare these alleles:

  • Quantitative RT-PCR: Measure dmfrn transcript levels in each mutant to correlate expression reduction with phenotypic severity.

  • Iron supplementation tests: Determine the differential response of each allele to dietary iron manipulation, providing insight into the relationship between allele strength and iron metabolism.

  • Phenotypic analysis across tissues: While male sterility is prominent, systematic examination of other tissues might reveal additional phenotypes in stronger alleles.

  • Genetic interaction studies: Combine dmfrn alleles with mutations in other iron metabolism genes to identify pathway relationships.

What methodological considerations are important when studying iron-dependent processes in Drosophila mitochondria?

Studying iron-dependent mitochondrial processes requires careful experimental design:

  • Dietary control: Standard Drosophila media contains variable iron levels. Use defined media with precise iron concentrations for consistent results. Consider using metal-depleted yeast to eliminate this variable iron source.

  • Tissue-specific analysis: As shown with dmfrn, expression patterns may vary between tissues . Always verify findings across multiple tissues rather than relying on whole-organism data.

  • Genetic background effects: Maintain consistent genetic backgrounds when comparing mutant lines, as modifier genes can influence iron metabolism phenotypes.

  • Iron quantification methods: Employ multiple techniques (colorimetric assays, ICP-MS, Perl's staining) to accurately measure iron levels in specific tissues or subcellular compartments.

  • Oxidative stress controls: Include measurements of oxidative stress markers, as iron dysregulation often leads to ROS production that can confound phenotypic interpretation.

  • Temporal considerations: Iron requirements may change during development and aging. Design experiments to capture these dynamics rather than single time-point analyses.

  • Parallel mammalian studies: When possible, conduct parallel experiments in mammalian systems to identify conserved mechanisms, as many iron metabolism pathways are evolutionarily conserved .

These methodological considerations help ensure reliable and reproducible results when investigating iron-dependent mitochondrial processes.

How can dmfrn research inform our understanding of human mitochondrial disorders?

Research on Drosophila mitoferrin has significant translational potential for understanding human mitochondrial disorders:

  • Conserved pathways: Drosophila dmfrn is functionally similar to human mitoferrin2, which is broadly expressed in non-erythroid tissues . Insights from dmfrn studies can inform understanding of human mitoferrin2 function.

  • Spermatogenesis disorders: The established role of dmfrn in male fertility suggests that mitoferrin2 might be involved in human male infertility cases with mitochondrial etiology.

  • Iron metabolism disorders: Human disorders of iron metabolism, particularly those affecting mitochondrial iron utilization, might be modeled using dmfrn mutants with appropriate genetic modifications.

  • Drug screening platform: Drosophila dmfrn mutants could serve as an in vivo platform for screening compounds that modulate mitochondrial iron transport, potentially identifying therapeutics for human disorders.

  • Aging studies: The connection between mitochondrial function, iron metabolism, and aging processes can be investigated using dmfrn mutants, as related proteins (like REC) have been shown to prevent age-associated mtDNA damage .

Researchers should consider establishing collaborative studies that parallel findings from dmfrn research with clinical investigations of human mitoferrin2-related disorders.

What approaches would enable high-throughput screening for modulators of dmfrn function?

Developing high-throughput screening (HTS) systems for dmfrn modulators requires innovative experimental designs:

  • Cell-based reporter systems: Generate Drosophila S2 cell lines with iron-responsive elements driving fluorescent or luminescent reporters that respond to changes in cellular iron status mediated by dmfrn.

  • In vivo screening platforms: Develop transgenic flies with iron-responsive reporters that can be used to screen for compounds or genetic modifiers that alter dmfrn function.

  • Growth-based yeast screens: Utilize yeast Mrs3/4 mutants complemented with dmfrn for growth-based screens in iron-limited media with compound libraries.

  • Mitochondrial membrane potential assays: Design assays based on mitochondrial membrane potential changes that occur with altered iron transport.

  • Automated fertility screening: Develop automated systems to assess male fertility in dmfrn hypomorphic mutants treated with potential modulating compounds.

For drug screening applications, begin with validated dmfrn mutations of intermediate severity that show responsiveness to iron level manipulations, as these would be most likely to demonstrate measurable responses to chemical modulators.

How might CRISPR/Cas9 technology enhance studies of dmfrn function and regulation?

CRISPR/Cas9 technology offers advanced approaches for studying dmfrn:

  • Endogenous tagging: Generate knock-in flies with fluorescent tags on dmfrn at the endogenous locus, avoiding potential artifacts from overexpression or ectopic expression .

  • Tissue-specific knockdown: Use tissue-specific Cas9 expression with dmfrn-targeted gRNAs to create conditional knockouts, allowing investigation of dmfrn function in specific tissues while avoiding lethality.

  • Regulatory element analysis: Create precise deletions or modifications of dmfrn regulatory elements to study transcriptional regulation.

  • Humanized dmfrn: Replace the Drosophila dmfrn gene with human mitoferrin2 to directly test functional conservation and create a platform for studying human variants.

  • Domain-specific mutations: Generate precise amino acid substitutions to identify functional domains and create allelic series of varying severity.

  • Mitochondrial targeting signal manipulations: Create variants with altered mitochondrial targeting signals to study protein import mechanisms.

CRISPR-based approaches overcome limitations of traditional P-element insertions by offering greater precision in genetic modifications and expanding the repertoire of experimental possibilities.

How do findings from dmfrn research integrate with broader understanding of mitochondrial biology?

Drosophila mitoferrin research contributes to our understanding of mitochondrial biology in several key ways:

  • Evolutionary conservation of iron transport: The functional similarity between dmfrn and vertebrate mitoferrins demonstrates evolutionary conservation of mitochondrial iron transport mechanisms .

  • Tissue-specific mitochondrial requirements: The pronounced effects of dmfrn mutations on spermatogenesis highlight the specialized requirements of mitochondria in different tissues .

  • Coordination of nuclear and mitochondrial processes: Similar to other dual-targeted proteins involved in mtDNA maintenance (like REC ), research on iron metabolism proteins reveals coordination between nuclear and mitochondrial processes.

  • Developmental regulation of mitochondrial function: The stage-specific expression of dmfrn during spermatogenesis exemplifies how mitochondrial processes are developmentally regulated.

  • Environmental influences on mitochondrial function: The impact of dietary iron levels on dmfrn mutant phenotypes demonstrates how environmental factors influence mitochondrial processes.

Integrating findings from dmfrn research with studies of other mitochondrial processes provides a more comprehensive understanding of mitochondrial biology and its relevance to development, aging, and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.