Recombinant Drosophila melanogaster Mpv17-like protein (CG11077)

Shipped with Ice Packs
In Stock

Description

Mitochondrial DNA Maintenance

  • mtDNA Depletion: Knockout (KO) of dMpv17 causes severe mtDNA loss in Drosophila fat bodies (analogous to human liver) and moderate depletion in other tissues .

  • Energy Metabolism:

    • Reduced ATP synthesis

    • Increased lactate levels (2.3–2.8-fold) and glycolytic flux

    • Elevated reactive oxygen species (ROS)

Ion Channel Activity

  • Electrophysiological Properties:

    Condition/MutationChannel ConductanceFunctional Impact
    Wild-type dMpv1785 pS (physiological KCl)Regulates inner mitochondrial membrane potential (ΔΨm)
    S163F mutationPrevents full channel openingDisrupts ΔΨm, mimicking human S170F
    R41Q mutationReduces conductance to 55 pSLinked to milder neuropathic phenotypes

Neurological Defects

  • Locomotor/Cognitive Deficits: Neuron-specific knockdown in larvae results in:

    • Impaired crawling speed and learning ability

    • Abnormal neuromuscular junction morphology

Metabolic Dysregulation

  • Mitochondrial Dysfunction:

    • 60% reduction in mtDNA copy number

    • 40% decrease in ATP levels

    • 2.8-fold increase in CNS lactate

Comparative Pathogenicity

MutationHuman Disease AssociationDrosophila Phenotype
R41Q (R50Q)MDDS/CMTModerate mtDNA depletion, locomotor defects
S163F (S170F)MDDSSevere ΔΨm loss, increased ROS

Recombinant Protein Use Cases

  • ELISA Assays: Commercial kits (e.g., CSB-CF894642DLU) utilize this protein for quantitative studies .

  • Channel Activity Studies: Reconstituted in planar lipid bilayers to analyze ion transport .

  • Interaction Mapping: Binds Drosophila MICOS component dMic19, suggesting a role in mitochondrial cristae organization .

Research Implications

This recombinant protein provides a tractable model to:

  1. Elucidate MPV17’s role in mtDNA stability and ROS regulation .

  2. Test therapeutic candidates for MDDS/CMT using Drosophila genetic tools .

  3. Investigate evolutionary conservation of MPV17 function across species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
CG11077; Mpv17-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Drosophila melanogaster (Fruit fly)
Target Names
CG11077
Target Protein Sequence
MKRLKAYLKDGINVAAVMCLGDTISQFFFDKKSLDEWDAGRTLRFGIVGLVFVGPTLRRW YHFLESRVPKTYSPMRRGVTKMLVDQTLFAPPFTMAMSFLVPLSNGEPIDRIRQRILDSY LSILVRNYMLWPAAQMLNFRFVPLGYQVLYAQFIALVWNCYLSMILNS
Uniprot No.

Target Background

Function
This protein is involved in mitochondrial homeostasis.
Database Links

KEGG: dme:Dmel_CG11077

STRING: 7227.FBpp0088286

UniGene: Dm.5907

Protein Families
Peroxisomal membrane protein PXMP2/4 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is CG11077 and why is it significant for research?

CG11077, also known as Drosophila Mpv17 (dMpv17), is a Drosophila ortholog of human MPV17. This protein is significant because mutations in human MPV17 are responsible for MPV17-related hepatocerebral mitochondrial DNA depletion syndrome and Charcot-Marie-Tooth (CMT) disease. The amino acid sequence alignment indicates strong conservation of the MPV17/PMP22 domain between Drosophila and humans, making CG11077 an excellent model for studying these human diseases . Phylogenetic analysis clearly identifies CG11077 as the best candidate for a Drosophila ortholog of human MPV17 among the ten MPV17/PMP22 family genes in the Drosophila genome .

How does CG11077 relate to human MPV17 at the molecular level?

CG11077 shares significant sequence similarity with human MPV17, particularly in the conserved MPV17/PMP22 domain. The mutations identified in patients with MPV17-related hepatocerebral mitochondrial DNA depletion syndrome (R50Q) and CMT (P98L, R41Q) involve amino acid residues that are identical or highly similar between Drosophila and humans . This conservation suggests functional similarity and makes the Drosophila model especially relevant for investigating the neurological aspects of MPV17-related diseases, which have been challenging to study in other model organisms .

What cellular functions are associated with dMpv17 protein?

Based on research findings, dMpv17 appears to play crucial roles in mitochondrial function. When knocked down in Drosophila larvae, researchers observed:

  • Reduced mitochondrial DNA levels

  • Decreased ATP production

  • Increased lactate levels

  • Elevated reactive oxygen species

  • Abnormal morphology of the neuromuscular junction, particularly at the presynaptic terminal

These findings suggest that dMpv17 is essential for maintaining mitochondrial integrity, energy production, and proper neuronal function, similar to the role of MPV17 in humans.

Why is Drosophila melanogaster advantageous for modeling MPV17-related disorders?

Drosophila melanogaster offers several distinct advantages for modeling MPV17-related disorders that other model systems have failed to capture. Previous models using mouse, zebrafish, and cultured human cells did not demonstrate the neurological defects commonly observed in patients with MPV17 mutations. In contrast, neuron-specific knockdown of dMpv17 in Drosophila successfully reproduces both locomotor and cognitive defects dependent on mitochondrial dysfunction . Additionally, Drosophila provides various genetic tools to investigate genetically interacting factors and therapeutic candidates relatively easily, making it particularly suitable for studying these diseases .

How is a neuron-specific dMpv17 knockdown model generated?

To generate a neuron-specific dMpv17 knockdown model, researchers use the following approach:

  • Select appropriate RNA interference (RNAi) constructs targeting the CG11077 gene

  • Utilize the GAL4-UAS system, specifically employing a neural-specific promoter driving GAL4 expression

  • Cross flies carrying the UAS-dMpv17-RNAi construct with those expressing GAL4 under neural-specific promoter control

  • Confirm knockdown efficiency through quantitative RT-PCR or Western blot analysis

  • Verify phenotypes by comparing with appropriate genetic controls

This approach ensures tissue-specific knockdown, allowing researchers to study the neurological aspects of MPV17 deficiency without affecting other tissues, which is particularly valuable given that patients with MPV17 mutations often present with neurological symptoms .

What behavioral assays are most appropriate for evaluating dMpv17 knockdown phenotypes?

Based on research findings, the following behavioral assays are most appropriate for evaluating dMpv17 knockdown phenotypes:

  • Locomotor activity assays: Measure crawling distance and velocity of larvae on agar plates, which effectively demonstrates impaired motor function in dMpv17 knockdown larvae

  • Learning ability tests: Utilize associative learning paradigms to assess cognitive defects

  • Neuromuscular junction (NMJ) electrophysiology: Record synaptic transmission at the larval NMJ to identify functional deficits

  • Stress response assays: Evaluate responses to oxidative stress inducers to assess mitochondrial functional integrity

These assays collectively provide comprehensive evaluation of the neurological phenotypes associated with dMpv17 deficiency, capturing both motor and cognitive aspects of the human diseases.

What key parameters should be measured when studying mitochondrial dysfunction in dMpv17 knockdown models?

When studying mitochondrial dysfunction in dMpv17 knockdown models, researchers should measure the following key parameters:

ParameterMeasurement MethodExpected Result in dMpv17 KnockdownSignificance
Mitochondrial DNA contentqPCR comparing mitochondrial to nuclear DNA ratioReduced mtDNA levelsIndicates mtDNA depletion similar to human disorder
ATP productionLuciferase-based ATP assayDecreased ATP levelsReflects impaired energy metabolism
Lactate levelsColorimetric lactate assayIncreased lactateIndicates shift to anaerobic metabolism
Reactive oxygen species (ROS)Fluorescent probes (e.g., DCFDA)Elevated ROS levelsSuggests oxidative stress
Neuromuscular junction morphologyImmunofluorescence microscopyAbnormal presynaptic terminalsReflects neuronal structural defects
Locomotor activityTracking larval movementReduced crawling distance/speedFunctional consequence of neuronal defects

These parameters collectively provide a comprehensive assessment of mitochondrial function and neurological consequences in the model system .

How should researchers control for off-target effects in RNAi-mediated dMpv17 knockdown?

To control for off-target effects in RNAi-mediated dMpv17 knockdown, researchers should implement the following strategies:

  • Use multiple independent RNAi lines: Employ at least two different RNAi constructs targeting different regions of the dMpv17 gene to confirm consistent phenotypes

  • Include appropriate genetic controls: Use UAS-RNAi lines crossed with wild-type flies (without GAL4) and GAL4 driver lines crossed with control UAS lines

  • Perform rescue experiments: Demonstrate phenotype rescue by expressing RNAi-resistant dMpv17 or human MPV17 in knockdown backgrounds

  • Verify knockdown specificity: Quantify expression levels of dMpv17 and closely related genes to ensure specific targeting

  • Compare with established mutant phenotypes: When available, compare RNAi phenotypes with those of characterized genetic mutations

These controls are essential for establishing the specificity of observed phenotypes and ruling out potential artifacts from the knockdown approach.

What statistical approaches are most appropriate for analyzing phenotypic data from dMpv17 models?

When analyzing phenotypic data from dMpv17 models, the following statistical approaches are most appropriate:

  • For comparing two groups (e.g., control vs. knockdown):

    • Student's t-test for normally distributed data

    • Mann-Whitney U test for non-normally distributed data

  • For multiple group comparisons (e.g., wild-type, knockdown, rescue):

    • One-way ANOVA followed by post-hoc tests (Tukey's or Bonferroni) for normally distributed data

    • Kruskal-Wallis test followed by Dunn's test for non-normally distributed data

  • For behavioral data with multiple time points:

    • Repeated measures ANOVA with appropriate post-hoc tests

    • Mixed-effects models for handling missing data points

  • For survival or developmental timing:

    • Kaplan-Meier analysis with log-rank test

  • For correlation analysis:

    • Pearson's correlation for parametric data

    • Spearman's rank correlation for non-parametric data

How can the dMpv17 model be used to screen for potential therapeutic compounds?

The dMpv17 knockdown Drosophila model provides an excellent platform for screening potential therapeutic compounds for MPV17-related diseases through the following approach:

  • High-throughput behavioral screening:

    • Assess improvements in locomotor activity following compound administration

    • Utilize automated tracking systems to quantify behavioral parameters

  • Mitochondrial function rescue assessment:

    • Test compounds for their ability to restore mitochondrial DNA levels

    • Measure ATP production recovery

    • Evaluate reduction in ROS levels

    • Assess normalization of lactate production

  • Neuromuscular junction morphology:

    • Examine whether compounds can restore normal presynaptic terminal structure

  • Genetic modifier screening:

    • Combine chemical treatments with genetic manipulations to identify synergistic effects

    • Screen for genetic backgrounds that enhance or suppress therapeutic effects

  • Compound delivery optimization:

    • Test different administration methods (food supplementation, injection, etc.)

    • Establish dose-response relationships for promising compounds

This approach leverages the genetic tractability and relatively rapid life cycle of Drosophila to efficiently identify promising therapeutic candidates that can subsequently be validated in mammalian models.

What insights can tissue-specific expression of dMpv17 provide about the pathophysiology of MPV17-related disorders?

Tissue-specific expression studies of dMpv17 can provide critical insights into the pathophysiology of MPV17-related disorders:

  • Tissue vulnerability mapping:

    • By selectively knocking down dMpv17 in different tissues (neurons, muscles, glia, oenocytes, fat body), researchers can identify which tissues are most sensitive to MPV17 deficiency

    • This helps explain the organ-specific manifestations observed in patients

  • Temporal requirements analysis:

    • Using temperature-sensitive GAL4 systems, researchers can manipulate dMpv17 expression at different developmental stages

    • This reveals critical periods when MPV17 function is most essential

  • Cell-autonomous vs. non-autonomous effects:

    • Mosaic analysis can determine whether phenotypes result from cell-autonomous defects or from disruption of intercellular signaling

    • This distinguishes primary from secondary pathological processes

  • Metabolic pathway interactions:

    • Tissue-specific expression can reveal different metabolic dependencies across tissues

    • For instance, comparing oenocyte-specific (liver-like) knockdown with neuron-specific knockdown may explain the hepatocerebral nature of the human syndrome

Such studies are particularly valuable given that patients with MPV17 mutations display both hepatocerebral and peripheral nerve symptoms, suggesting tissue-specific vulnerabilities that can be systematically mapped in Drosophila.

How do dMpv17 function and human MPV17 mutations correlate at the molecular level?

The correlation between dMpv17 function and human MPV17 mutations at the molecular level provides important insights:

  • Structure-function relationships:

    • Human disease-causing mutations (R50Q, P98L, R41Q) occur at conserved residues between human and Drosophila Mpv17

    • These mutations can be recreated in dMpv17 using CRISPR/Cas9 genome editing to study their specific effects on protein function and localization

  • Molecular mechanisms of pathogenicity:

    • Recombinant expression of wild-type and mutant dMpv17 proteins can reveal:

      • Altered protein stability

      • Impaired mitochondrial import

      • Changes in protein interaction partners

      • Disruption of channel function (as Mpv17 forms an ion channel)

  • Rescue experiments:

    • Testing whether human wild-type MPV17 can rescue dMpv17 knockdown phenotypes

    • Determining if human mutant forms fail to rescue or show partial rescue

    • These experiments establish functional conservation and validate the disease relevance of specific mutations

  • Interacting protein networks:

    • Proteomic analysis of dMpv17 interactors compared to human MPV17 interactors

    • Identification of conserved binding partners affected by disease-causing mutations

These approaches collectively establish whether mutations affect protein function through similar molecular mechanisms across species, validating the relevance of the Drosophila model for human disease.

What are common challenges in generating viable dMpv17 knockdown lines and how can they be addressed?

Researchers may encounter several challenges when generating viable dMpv17 knockdown lines:

  • Embryonic lethality with strong knockdown:

    • Solution: Use inducible expression systems (e.g., GeneSwitch or temperature-sensitive GAL80) to activate knockdown after embryonic development

    • Solution: Test multiple RNAi lines with varying knockdown efficiency to identify viable combinations

  • Variable knockdown efficiency:

    • Solution: Screen multiple independent transformant lines

    • Solution: Quantify knockdown at both mRNA and protein levels to select lines with consistent efficiency

    • Solution: Consider genomic position effects when interpreting results

  • Genetic background effects:

    • Solution: Backcross lines to standardize genetic background

    • Solution: Include multiple genetic background controls in experiments

  • Compensatory effects from related genes:

    • Solution: Consider knockdown of multiple family members simultaneously

    • Solution: Analyze expression of related genes to identify potential compensation

  • Balancing knockdown efficiency and viability:

    • Solution: Use tissue-specific rather than ubiquitous drivers

    • Solution: Consider weak or moderate GAL4 drivers for genes with essential functions

These strategies help researchers overcome technical challenges and generate viable models that accurately reflect the consequences of dMpv17 deficiency.

How should researchers prepare recombinant dMpv17 protein for functional studies?

For functional studies requiring recombinant dMpv17 protein, researchers should follow these methodological guidelines:

  • Expression system selection:

    • Bacterial expression: Use E. coli systems (e.g., BL21(DE3)) with careful optimization of induction conditions, as membrane proteins like dMpv17 can be challenging to express

    • Insect cell expression: Consider Sf9 or High Five cells for better folding of Drosophila proteins

    • Cell-free expression: Useful for potentially toxic membrane proteins

  • Construct design:

    • Include appropriate affinity tags (His, FLAG, etc.) for purification

    • Consider fusion partners to enhance solubility (e.g., MBP, SUMO)

    • Engineered cleavage sites to remove tags after purification

    • Codon optimization for the chosen expression system

  • Protein purification strategy:

    • Membrane extraction using appropriate detergents (e.g., DDM, CHAPS)

    • Two-step purification combining affinity chromatography and size exclusion

    • Quality control by SDS-PAGE, Western blot, and mass spectrometry

  • Functional assessment approaches:

    • Reconstitution into liposomes for channel activity studies

    • Binding assays with potential interacting partners

    • Structural characterization (circular dichroism, limited proteolysis)

  • Storage conditions optimization:

    • Detergent concentration

    • Buffer composition

    • Glycerol percentage

    • Flash-freezing protocols

Careful attention to these methodological details is essential for obtaining functional recombinant dMpv17 protein suitable for downstream applications.

How can researchers address data inconsistencies when comparing dMpv17 models with other MPV17 animal models?

When addressing data inconsistencies between dMpv17 models and other MPV17 animal models (e.g., mouse, zebrafish), researchers should implement the following strategies:

  • Systematic comparative analysis:

    • Create a detailed comparison table documenting phenotypes across model organisms

    • Note differences in genetic approach (knockout vs. knockdown)

    • Document tissue-specificity of manipulations

    • Consider developmental timing differences

  • Species-specific compensation mechanisms:

    • Investigate potential genetic redundancy (paralogous genes)

    • Examine expression of related family members following MPV17 disruption

    • Consider metabolic differences between species that might mask phenotypes

  • Methodological standardization:

    • Apply identical assays across model systems when possible

    • Standardize measurement techniques and analytical approaches

    • Use consistent genetic backgrounds within each model system

  • Molecular mechanism focus:

    • Compare molecular phenotypes (mtDNA levels, ATP production) rather than complex behavioral outcomes

    • Consider evolutionary conservation of interacting partners and pathways

    • Examine subcellular localization across species

  • Integration of human patient data:

    • Triangulate model organism findings with patient phenotypes

    • Prioritize models that best recapitulate human disease features

    • Consider tissue-specific effects reflecting human disease presentation

This systematic approach enables researchers to reconcile apparently contradictory findings and extract meaningful biological insights from cross-species comparisons.

How should researchers interpret mitochondrial phenotypes in the context of neurological symptoms?

When interpreting mitochondrial phenotypes in relation to neurological symptoms in dMpv17 models, researchers should consider:

  • Energy demand vs. supply mismatch:

    • Neurons have high energy requirements, making them particularly vulnerable to mitochondrial dysfunction

    • Correlation analysis between ATP depletion and severity of locomotor/learning deficits provides insight into this relationship

  • ROS-mediated damage mechanisms:

    • Quantify oxidative damage to proteins, lipids, and DNA in neural tissues

    • Test whether antioxidant treatments ameliorate neurological symptoms independently of ATP levels

    • Examine temporal relationship between ROS elevation and symptom onset

  • Neurodevelopmental vs. neurodegenerative components:

    • Distinguish between developmental defects and progressive deterioration

    • Utilize temporal control of gene knockdown to separate these processes

    • Analyze neuromuscular junction development across time points

  • Cell-type specific vulnerabilities:

    • Compare effects in different neuronal populations (motor vs. sensory)

    • Analyze glia-specific responses to mitochondrial dysfunction

    • Examine neuron-glia interactions in disease progression

  • Threshold effects:

    • Determine whether neurological symptoms follow linear or threshold relationship with mitochondrial defects

    • Establish quantitative relationships between mtDNA depletion and functional deficits

This integrated interpretation approach connects molecular mitochondrial phenotypes to the complex neurological manifestations observed in both the model organism and human patients.

What novel research directions does the dMpv17 model enable for MPV17-related diseases?

The dMpv17 model opens several novel research directions for MPV17-related diseases:

  • Genetic modifier screening:

    • Genome-wide screens to identify enhancers and suppressors of dMpv17 phenotypes

    • Discovery of novel therapeutic targets and pathways

  • Metabolic bypass mechanisms:

    • Testing whether alternative metabolic pathways can compensate for mitochondrial dysfunction

    • Investigating metabolic interventions (ketogenic approaches, amino acid supplementation)

  • Mitochondrial dynamics and quality control:

    • Examining relationships between dMpv17 and mitochondrial fission/fusion machinery

    • Analyzing mitophagy rates and mitochondrial turnover in disease models

  • Non-neural tissue contributions:

    • Investigation of oenocyte (liver-like tissue) specific knockdown to model hepatic aspects

    • Analysis of potential interorgan signaling affecting neural function

  • Channel function characterization:

    • Detailed electrophysiological studies of dMpv17 as an ion channel

    • Structure-function analysis of channel properties affected by disease mutations

  • Precision medicine approaches:

    • Testing mutation-specific interventions based on particular molecular defects

    • Development of personalized therapeutic strategies for different MPV17 mutations

These research directions leverage the unique advantages of the Drosophila model system while addressing fundamental questions about disease mechanisms and therapeutic opportunities.

How can integrated multi-omics approaches enhance our understanding of dMpv17 function?

Integrated multi-omics approaches can significantly enhance understanding of dMpv17 function through:

  • Combined transcriptomic and proteomic analysis:

    • Identify discrepancies between mRNA and protein levels indicating post-transcriptional regulation

    • Discover compensatory responses at gene expression level

    • Map tissue-specific responses to dMpv17 deficiency

  • Metabolomic profiling:

    • Characterize metabolic alterations beyond ATP and lactate

    • Identify novel biomarkers of mitochondrial dysfunction

    • Discover unexpected metabolic adaptations

  • Mitochondrial proteome analysis:

    • Define changes in mitochondrial protein composition

    • Identify altered post-translational modifications

    • Map protein-protein interaction networks affected by dMpv17 deficiency

  • Integration with functional data:

    • Correlate multi-omics datasets with behavioral phenotypes

    • Develop predictive models of disease progression

    • Identify early molecular changes preceding symptom onset

  • Comparative multi-omics across species:

    • Parallel analysis of Drosophila, mouse, and human samples

    • Identify conserved and divergent responses to MPV17 deficiency

    • Validate disease relevance of findings through cross-species comparison

This integrated approach provides a systems-level understanding of dMpv17 function and disease mechanisms, potentially revealing unexpected therapeutic opportunities and biomarkers for MPV17-related diseases.

What are the key considerations for choosing between different dMpv17 model systems?

When selecting between different dMpv17 model systems for specific research questions, researchers should consider:

  • Research question alignment:

    • For neurological studies: neuron-specific knockdown models

    • For hepatic aspects: oenocyte-specific models

    • For developmental roles: temporal control systems

  • Technical considerations:

    • Knockdown vs. knockout (RNAi vs. CRISPR)

    • Constitutive vs. inducible systems

    • Global vs. tissue-specific approaches

  • Phenotype severity and viability:

    • Complete loss vs. partial reduction of function

    • Embryonic lethality vs. adult-onset phenotypes

    • Acute vs. progressive manifestations

  • Experimental compatibility:

    • Behavioral assay requirements

    • Imaging needs (fluorescent markers, tissue accessibility)

    • Biochemical analysis considerations

  • Translational relevance:

    • Alignment with human disease features

    • Suitability for drug screening

    • Compatibility with potential therapeutic approaches

Careful consideration of these factors ensures selection of the most appropriate model system for specific research objectives, maximizing scientific impact and translational potential.

What standardized protocols should researchers follow when reporting dMpv17 knockdown studies?

To ensure reproducibility and comparability across studies, researchers should follow these standardized reporting protocols for dMpv17 knockdown studies:

  • Genetic details:

    • Complete genotypes of all strains used

    • Source of RNAi lines with catalog numbers

    • GAL4 driver specificity and expression pattern documentation

    • Genetic background information

  • Knockdown validation:

    • Quantitative RT-PCR methodology and primers

    • Protein quantification approach

    • Off-target effect assessment

  • Phenotypic characterization:

    • Detailed methodological protocols for behavioral assays

    • Sample sizes and power calculations

    • Blinding procedures for subjective assessments

    • Age and sex of animals tested

  • Mitochondrial function assessment:

    • Detailed protocols for mtDNA quantification

    • ATP measurement methodology

    • ROS detection approach and reagents

    • Microscopy parameters for morphological analysis

  • Data analysis transparency:

    • Raw data availability

    • Statistical tests applied with justification

    • Effect size reporting

    • Treatment of outliers

Adherence to these reporting standards enhances scientific rigor and facilitates meta-analysis and replication studies in the field.

How can findings from dMpv17 models be effectively translated to clinical applications?

To effectively translate findings from dMpv17 models to clinical applications for MPV17-related diseases, researchers should:

  • Establish human relevance:

    • Validate key findings in patient-derived cells

    • Create parallel human cellular models using CRISPR/Cas9

    • Test whether human MPV17 complements dMpv17 deficiency

  • Prioritize therapeutic targets:

    • Focus on druggable pathways identified in Drosophila screens

    • Validate targets across multiple model systems

    • Prioritize interventions affecting conserved mechanisms

  • Develop translational biomarkers:

    • Identify molecular signatures that translate across species

    • Develop assays applicable to patient samples

    • Establish predictive biomarkers of disease progression

  • Design clinically feasible interventions:

    • Consider blood-brain barrier penetration for neurological symptoms

    • Develop tissue-targeted delivery approaches

    • Focus on repurposing approved drugs when possible

  • Establish clinical research collaborations:

    • Partner with clinical experts in mitochondrial diseases

    • Develop patient registries for MPV17-related disorders

    • Design natural history studies to enable clinical trial readiness

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.